You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ARMC9
LisH domain-containing protein ARMC9

Protein Summary
Description
Required for ciliogenesis.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000611582
  • ENSP00000484804
  • ENSG00000135931
  • ENST00000614261
  • ENSP00000484241

Symbol
  • KIAA1868
  • ARM
  • NS21
  • JBTS30
  • KU-MEL-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.91
histone modification site profile
0.76
phenotype
0.7
transcription factor binding site profile
0.69
kinase perturbation
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 42.72   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 101   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 42.72   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 101   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (42)
1 – 10 of 42
EPHA1
Tchem
Family: Kinase
Novelty: 0.00080325
p_int: 0.999915311
p_ni: 0.000068189
p_wrong: 0.000016499
Score: 0.202
Data Source: BioPlex,STRINGDB
SNAPC5
Tdark
Novelty: 1.40939597
Score: 0.762
Data Source: STRINGDB
ARMC1
Tbio
Novelty: 0.02013423
Score: 0.727
Data Source: STRINGDB
RHBDD1
Tbio
Family: Enzyme
Novelty: 0.09204807
Score: 0.72
Data Source: STRINGDB
FBXO22
Tbio
Novelty: 0.161141
Score: 0.707
Data Source: STRINGDB
SNX24
Tdark
Novelty: 2.47058824
Score: 0.687
Data Source: STRINGDB
KLHDC1
Tbio
Novelty: 2.54545455
Score: 0.672
Data Source: STRINGDB
SIVA1
Tbio
Novelty: 0.05070056
Score: 0.671
Data Source: STRINGDB
DPH5
Tbio
Family: Enzyme
Novelty: 0.16551724
Score: 0.657
Data Source: STRINGDB
U2AF2
Tbio
Novelty: 0.00739606
Score: 0.646
Data Source: STRINGDB
Publication Statistics
PubMed Score  42.72

PubMed score by year
PubTator Score  11.8

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGDILAHESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKPLCKTVGGSFRDSKSLTIQKDLVAAFDNGD
1-70
QKVFFDLWEEHISSSIRDGDSFAQKLEFYLHIHFAIYLLKYSVGRPDKEELDEKISYFKTYLETKGAALS
70-140
QTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKLKLIKFLALISKASNTPKLLTIYKENGQSNKEIL
140-210
QQLHQQLVEAERRSVTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ
210-280
SLAHSVDFTRPGTASTMLRASLAPVKLKDVPLLPSLDYEKLKKDLILGSDRLKAFLLQALRWRLTTSHPG
280-350
EQRETVLQAYISNDLLDCYSHNQRSVLQLLHSTSDVVRQYMARLINAFASLAEGRLYLAQNTKVLQMLEG
350-420
RLKEEDKDIITRENVLGALQKFSLRRPLQTAMIQDGLIFWLVDVLKDPDCLSDYTLEYSVALLMNLCLRS
420-490
TGKNMCAKVAGLVLKVLSDLLGHENHEIQPYVNGALYSILSVPSIREEARAMGMEDILRCFIKEGNAEMI
490-560
RQIEFIIKQLNSEELPDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTN
560-630
TGKTRRKGLANVQWSGDEPLQRPVTPGGHRNGYPVVEDQHTPPQTAQHARNGHPQALPAAHEAVYREGKP
630-700
STPESCVSSSSAIIAKPGEWLPRGRQEEPRPAPTGTPRQPREAPQDPGNGVTTRECASAFTCKPRAPCTP
700-770
EMLDWNPPKAKASVLAPLFSSCGPQQASRPGSTASSTRGLPSSQSHRK
770-818
MGDILAHESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKPLCKTVGGSFRDSKSLTIQKDLVAAFDNGDQKVFFDLWEEHISSSIRDGDSFAQKLEFYLHIHFAIYLLKYSVGRPDKEELDEKISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPSFKELFQDSWTPELKLKLIKFLALISKASNTPKLLTIYKENGQSNKEILQQLHQQLVEAERRSVTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQSLAHSVDFTRPGTASTMLRASLAPVKLKDVPLLPSLDYEKLKKDLILGSDRLKAFLLQALRWRLTTSHPGEQRETVLQAYISNDLLDCYSHNQRSVLQLLHSTSDVVRQYMARLINAFASLAEGRLYLAQNTKVLQMLEGRLKEEDKDIITRENVLGALQKFSLRRPLQTAMIQDGLIFWLVDVLKDPDCLSDYTLEYSVALLMNLCLRSTGKNMCAKVAGLVLKVLSDLLGHENHEIQPYVNGALYSILSVPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSEELPDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKTRRKGLANVQWSGDEPLQRPVTPGGHRNGYPVVEDQHTPPQTAQHARNGHPQALPAAHEAVYREGKPSTPESCVSSSSAIIAKPGEWLPRGRQEEPRPAPTGTPRQPREAPQDPGNGVTTRECASAFTCKPRAPCTPEMLDWNPPKAKASVLAPLFSSCGPQQASRPGSTASSTRGLPSSQSHRK