You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PHF19
PHD finger protein 19

Protein Summary
Description
Polycomb group (PcG) that specifically binds histone H3 trimethylated at 'Lys-36' (H3K36me3) and recruits the PRC2 complex. Probably involved in the transition from an active state to a repressed state in embryonic stem cells: acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting H3K36me3 histone demethylases RIOX1 or KDM2B, leading to demethylation of H3K36 and recruitment of the PRC2 complex that mediates H3K27me3 methylation, followed by de novo silencing. Recruits the PRC2 complex to CpG islands and contributes to embryonic stem cell self-renewal. Also binds dimethylated at 'Lys-36' (H3K36me2). Isoform 1 and isoform 2 inhibit transcription from an HSV-tk promoter.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000312189
  • ENSP00000310372
  • ENSG00000119403
  • ENST00000373896
  • ENSP00000363003

Symbol
  • PCL3
  • PCL3
  • MTF2L1
  • TDRD19B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.92
transcription factor perturbation
0.88
microRNA
0.85
PubMedID
0.74
histone modification site profile
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.39   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 142   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.39   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 142   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (3)
Epigenetic regulation of gene expression (R-HSA-212165)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Epigenetic regulation of gene expression
Reactome
Gene expression (Transcription)
Reactome
PRC2 methylates histones and DNA
Name
Explore in Pharos
Explore in Source
Epigenetic regulation of gene expression
Gene expression (Transcription)
PRC2 methylates histones and DNA
Protein-Protein Interactions (87)
1 – 10 of 87
SUZ12
Tbio
Novelty: 0.00668683
p_int: 1
Score: 0.986
Data Source: BioPlex,Reactome,STRINGDB
EZH2
Tclin
Family: Epigenetic
Novelty: 0.00057242
p_int: 0.999999896
p_ni: 1.02e-7
p_wrong: 3e-9
Score: 0.992
Data Source: BioPlex,Reactome,STRINGDB
NRBP2
Tdark
Family: Kinase
Novelty: 0.47244094
p_int: 0.999999428
p_ni: 5.14e-7
p_wrong: 5.8e-8
Score: 0.235
Data Source: BioPlex,STRINGDB
EZH1
Tchem
Family: Epigenetic
Novelty: 0.04277986
p_int: 0.999998633
p_ni: 0.000001349
p_wrong: 1.8e-8
Score: 0.941
Data Source: BioPlex,STRINGDB
EED
Tchem
Novelty: 0.00129663
p_int: 0.999991034
p_ni: 0.000008966
Score: 0.981
Data Source: BioPlex,Reactome,STRINGDB
CAMK1
Tchem
Family: Kinase
Novelty: 0.01518257
p_int: 0.999965841
p_ni: 0.000034159
Score: 0.183
Data Source: BioPlex,STRINGDB
GTF2F1
Tbio
Novelty: 0.0252356
p_int: 0.999929818
p_ni: 0.000070182
Score: 0.233
Data Source: BioPlex,STRINGDB
GSTCD
Tbio
Family: Enzyme
Novelty: 0.19076326
p_int: 0.999851308
p_ni: 0.000110507
p_wrong: 0.000038184
Score: 0.187
Data Source: BioPlex,STRINGDB
CHAMP1
Tbio
Novelty: 0.15765766
p_int: 0.999561017
p_ni: 0.000438381
p_wrong: 6.02e-7
Score: 0.189
Data Source: BioPlex,STRINGDB
PDLIM5
Tbio
Novelty: 0.00263369
p_int: 0.999555041
p_ni: 0.000444959
Score: 0.179
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  58.39

PubMed score by year
PubTator Score  70.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSC
1-70
LVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCGLGYHQQCHIPIAGSADQPLL
70-140
TPWFCRRCIFALAVRKGGALKKGAIARTLQAVKMVLSYQPEELEWDSPHRTNQQQCYCYCGGPGEWYLRM
140-210
LQCYRCRQWFHEACTQCLNEPMMFGDRFYLFFCSVCNQGPEYIERLPLRWVDVVHLALYNLGVQSKKKYF
210-280
DFEEILAFVNHHWELLQLGKLTSTPVTDRGPHLLNALNSYKSRFLCGKEIKKKKCIFRLRIRVPPNPPGK
280-350
LLPDKGLLPNENSASSELRKRGKSKPGLLPHEFQQQKRRVYRRKRSKFLLEDAIPSSDFTSAWSTNHHLA
350-420
SIFDFTLDEIQSLKSASSGQTFFSDVDSTDAASTSGSASTSLSYDSRWTVGSRKRKLAAKAYMPLRAKRW
420-490
AAELDGRCPSDSSAEGASVPERPDEGIDSHTFESISEDDSSLSHLKSSITNYFGAAGRLACGEKYQVLAR
490-560
RVTPEGKVQYLVEWEGTTPY
560-580
MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCGLGYHQQCHIPIAGSADQPLLTPWFCRRCIFALAVRKGGALKKGAIARTLQAVKMVLSYQPEELEWDSPHRTNQQQCYCYCGGPGEWYLRMLQCYRCRQWFHEACTQCLNEPMMFGDRFYLFFCSVCNQGPEYIERLPLRWVDVVHLALYNLGVQSKKKYFDFEEILAFVNHHWELLQLGKLTSTPVTDRGPHLLNALNSYKSRFLCGKEIKKKKCIFRLRIRVPPNPPGKLLPDKGLLPNENSASSELRKRGKSKPGLLPHEFQQQKRRVYRRKRSKFLLEDAIPSSDFTSAWSTNHHLASIFDFTLDEIQSLKSASSGQTFFSDVDSTDAASTSGSASTSLSYDSRWTVGSRKRKLAAKAYMPLRAKRWAAELDGRCPSDSSAEGASVPERPDEGIDSHTFESISEDDSSLSHLKSSITNYFGAAGRLACGEKYQVLARRVTPEGKVQYLVEWEGTTPY