You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IKBKG
NF-kappa-B essential modulator

Protein Summary
Description
Regulatory subunit of the IKK core complex which phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor. Its binding to scaffolding polyubiquitin seems to play a role in IKK activation by multiple signaling receptor pathways. However, the specific type of polyubiquitin recognized upon cell stimulation (either 'Lys-63'-linked or linear polyubiquitin) and its functional importance is reported conflictingly. Also considered to be a mediator for TAX activation of NF-kappa-B. Could be implicated in NF-kappa-B-mediated protection from cytokine toxicity. Essential for viral activation of IRF3. Involved in TLR3- and IFIH1-mediated antiviral innate response; this function requires 'Lys-27'-linked polyubiquitination. This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immuni ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000594239
  • ENSP00000471166
  • ENSG00000269335
  • ENST00000611071
  • ENSP00000479662
  • ENST00000611176
  • ENSP00000478616
  • ENST00000618670
  • ENSP00000483825

Symbol
  • FIP3
  • NEMO
  • IP
  • IP1
  • IP2
  • FIP3
  • IKKG
  • IPD2
  • NEMO
  • FIP-3
  • Fip3p
  • IMD33
  • AMCBX1
  • EDAID1
  • IKKAP1
  • ZC2HC9
  • IKK-gamma
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
hub protein
1
kinase perturbation
1
disease perturbation
0.99
pathway
0.98


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1234.5   (req: < 5)
Gene RIFs: 181   (req: <= 3)
Antibodies: 1102   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1234.5   (req: >= 5)
Gene RIFs: 181   (req: > 3)
Antibodies: 1102   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 37
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (190)
Activation of NF-kappaB in B cells (R-HSA-1169091)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 72
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of NF-kappaB in B cells
Reactome
Adaptive Immune System
Reactome
Antigen processing-Cross presentation
Reactome
C-type lectin receptors (CLRs)
Reactome
CLEC7A (Dectin-1) signaling
Name
Explore in Pharos
Explore in Source
Activation of NF-kappaB in B cells
Adaptive Immune System
Antigen processing-Cross presentation
C-type lectin receptors (CLRs)
CLEC7A (Dectin-1) signaling
Gene Ontology Terms (46)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
ParkinsonsUK-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
ParkinsonsUK-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (306)
1 – 10 of 306
IKBKB
Tchem
Family: Kinase
Novelty: 0.00107685
p_int: 0.999999996
p_ni: 2e-9
p_wrong: 2e-9
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
SDCCAG8
Tbio
Novelty: 0.06798507
p_int: 0.999999983
p_ni: 8e-9
p_wrong: 9e-9
Score: 0.189
Data Source: BioPlex,STRINGDB
CHUK
Tchem
Family: Kinase
Novelty: 0.00425902
p_int: 0.999999943
p_ni: 2.8e-8
p_wrong: 2.9e-8
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
MAP3K14
Tchem
Family: Kinase
Novelty: 0.0521973
p_int: 0.999994493
p_ni: 0.000005485
p_wrong: 2.2e-8
Score: 0.99
Data Source: BioPlex,STRINGDB
CENPF
Tbio
Novelty: 0.00870005
p_int: 0.999987051
p_ni: 0.000012949
Data Source: BioPlex
SYNC
Tbio
Novelty: 0.0425174
p_int: 0.999923656
p_ni: 0.000076334
p_wrong: 1e-8
Data Source: BioPlex
SEMA4C
Tbio
Novelty: 0.01413319
p_int: 0.999606906
p_ni: 0.000393055
p_wrong: 3.9e-8
Data Source: BioPlex
LTBR
Tbio
Novelty: 0.00438925
p_int: 0.998466916
p_ni: 0.001533073
p_wrong: 1.2e-8
Score: 0.42
Data Source: BioPlex,STRINGDB
INSYN2
Tdark
p_int: 0.998030021
p_ni: 0.001969957
p_wrong: 2.3e-8
Data Source: BioPlex
PTS
Tbio
Family: Enzyme
Novelty: 0.00144771
p_int: 0.995056081
p_ni: 0.00466857
p_wrong: 0.000275349
Data Source: BioPlex
Publication Statistics
PubMed Score  1234.50

PubMed score by year
PubTator Score  934.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQ
1-70
ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKA
70-140
SVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE
140-210
AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV
210-280
IDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQES
280-350
ARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
350-419
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE