You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ICOSLG
ICOS ligand

Protein Summary
Description
Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000344330
  • ENSP00000339477
  • ENSG00000160223
  • ENST00000400377
  • ENSP00000383228
  • ENST00000407780
  • ENSP00000384432

Symbol
  • B7H2
  • B7RP1
  • ICOSL
  • KIAA0653
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
phenotype
0.63
transcription factor
0.63
small molecule perturbation
0.62
histone modification site profile
0.61
disease
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 108.34   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 693   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 108.34   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 693   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Costimulation by the CD28 family
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Costimulation by the CD28 family
Immune System
Gene Ontology Terms (17)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (85)
1 – 10 of 85
ICOS
Tbio
Novelty: 0.0231652
p_int: 0.999998263
p_ni: 3.54e-7
p_wrong: 0.000001383
Score: 0.966
Data Source: BioPlex,Reactome,STRINGDB
ZDHHC6
Tbio
Family: Enzyme
Novelty: 0.25862069
p_int: 0.99810481
p_ni: 0.001855285
p_wrong: 0.000039906
Data Source: BioPlex
PTPRD
Tbio
Family: Enzyme
Novelty: 0.00348082
p_int: 0.978439419
p_ni: 0.021549691
p_wrong: 0.00001089
Data Source: BioPlex
LGALS1
Tchem
Novelty: 0.00134398
p_int: 0.932256597
p_ni: 0.067743402
Data Source: BioPlex
C2CD2L
Tbio
Novelty: 0.06105834
p_int: 0.924964432
p_ni: 0.070747538
p_wrong: 0.004288029
Data Source: BioPlex
PREB
Tbio
Family: TF
Novelty: 0.00430442
p_int: 0.839585789
p_ni: 0.160414211
Data Source: BioPlex
UPK3BL1
Tdark
p_int: 0.772887482
p_ni: 0.227112518
Data Source: BioPlex
CTLA4
Tclin
Novelty: 0.00017405
Score: 0.971
Data Source: STRINGDB
CD28
Tbio
Novelty: 0.00051946
Score: 0.962
Data Source: STRINGDB
CD40LG
Tbio
Novelty: 0.00002272
Score: 0.814
Data Source: STRINGDB
Publication Statistics
PubMed Score  108.34

PubMed score by year
PubTator Score  14.56

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQN
1-70
SSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSV
70-140
PVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPS
140-210
VNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDR
210-280
CLQHSYAGAWAVSPETELTGHV
280-302
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV