You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
GHR
Growth hormone receptor

Protein Summary
Description
Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to the JAK2/STAT5 pathway (By similarity). The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling. Isoform 2 up-regulates the production of GHBP and acts as a negative inhibitor of GH signaling. This gene encodes a member of the type I cytokine receptor family, which is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. In humans and rabbits, but not rodents, growth hormone binding protein (GHBP) is generated by proteolytic cleavage of the extracellular ligand-binding domain f ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000230882
  • ENSP00000230882
  • ENSG00000112964
  • ENST00000357703
  • ENSP00000350335
  • ENST00000537449
  • ENSP00000442206
  • ENST00000612382
  • ENSP00000478332
  • ENST00000612626
  • ENSP00000479846
  • ENST00000615111
  • ENSP00000478291
  • ENST00000618088
  • ENSP00000482373

Symbol
  • GHBP
  • GHIP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
disease perturbation
0.96
biological process
0.95
PubMedID
0.92
hub protein
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 901.83   (req: < 5)
Gene RIFs: 197   (req: <= 3)
Antibodies: 362   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 901.83   (req: >= 5)
Gene RIFs: 197   (req: > 3)
Antibodies: 362   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 37
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (35)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Growth hormone receptor signaling
Reactome
Immune System
Reactome
Prolactin receptor signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Growth hormone receptor signaling
Immune System
Prolactin receptor signaling
Gene Ontology Terms (48)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Protein-Protein Interactions (137)
1 – 10 of 137
GH1
Tbio
Novelty: 0.00082468
Score: 0.996
Data Source: Reactome,STRINGDB
JAK2
Tclin
Family: Kinase
Novelty: 0.00028252
Score: 0.989
Data Source: Reactome,STRINGDB
STAT5B
Tchem
Family: TF
Novelty: 0.00091216
Score: 0.983
Data Source: Reactome,STRINGDB
STAT5A
Tchem
Family: TF
Novelty: 0.00091229
Score: 0.982
Data Source: Reactome,STRINGDB
GH2
Tbio
Novelty: 0.00081585
Score: 0.975
Data Source: Reactome,STRINGDB
SOCS3
Tbio
Novelty: 0.00082008
Score: 0.973
Data Source: Reactome,STRINGDB
SOCS2
Tbio
Novelty: 0.00459272
Score: 0.97
Data Source: Reactome,STRINGDB
CISH
Tbio
Novelty: 0.00075253
Score: 0.969
Data Source: Reactome,STRINGDB
PRL
Tbio
Novelty: 0.00010121
Score: 0.962
Data Source: STRINGDB
IRS1
Tbio
Novelty: 0.00061858
Score: 0.96
Data Source: STRINGDB
Publication Statistics
PubMed Score  901.83

PubMed score by year
PubTator Score  1049.49

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDLWQLLLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTD
1-70
EVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKC
70-140
FSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPI
140-210
LTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFYFPWLLIIIFGIFGLTV
210-280
MLFVFLFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDI
280-350
DEPDEKTEESDTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFNANDIHEGTSEVAQPQRLKGE
350-420
ADLLCLDQKNQNNSPYHDACPATQQPSVIQAEKNKPQPLPTEGAESTHQAAHIQLSNPSSLSNIDFYAQV
420-490
SDITPAGSVVLSPGQKNKAGMSQCDMHPEMVSLCQENFLMDNAYFCEADAKKCIPVAPHIKVESHIQPSL
490-560
NQEDIYITTESLTTAAGRPGTGEHVPGSEMPVPDYTSIHIVQSPQGLILNATALPLPDKEFLSSCGYVST
560-630
DQLNKIMP
630-638
MDLWQLLLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKTEESDTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFNANDIHEGTSEVAQPQRLKGEADLLCLDQKNQNNSPYHDACPATQQPSVIQAEKNKPQPLPTEGAESTHQAAHIQLSNPSSLSNIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHPEMVSLCQENFLMDNAYFCEADAKKCIPVAPHIKVESHIQPSLNQEDIYITTESLTTAAGRPGTGEHVPGSEMPVPDYTSIHIVQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP