You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
ADRA2B
Alpha-2B adrenergic receptor

Protein Summary
Description
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The rank order of potency for agonists of this receptor is clonidine > norepinephrine > epinephrine = oxymetazoline > dopamine > p-tyramine = phenylephrine > serotonin > p-synephrine / p-octopamine. For antagonists, the rank order is yohimbine > chlorpromazine > phentolamine > mianserine > spiperone > prazosin > alprenolol > propanolol > pindolol. This intronless gene encodes a seven-pass transmembrane protein. This protein is a member of a subfamily of G protein-coupled receptors that regulate neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system. [provided by RefSeq, Apr 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000620793
  • ENSP00000480573
  • ENSG00000274286

Symbol
  • ADRA2L1
  • ADRA2RL1
  • FAME2
  • ADRA2L1
  • ADRARL1
  • ADRA2RL1
  • ALPHA2BAR
  • alpha-2BAR
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug
1
biological process
0.95
ligand (chemical)
0.94
cell type or tissue
0.76
biological term
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 949.7   (req: < 5)
Gene RIFs: 87   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 949.7   (req: >= 5)
Gene RIFs: 87   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 120
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 51
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (19)
Adrenaline signalling through Alpha-2 adrenergic receptor (R-HSA-392023)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adrenaline signalling through Alpha-2 adrenergic receptor
Reactome
Adrenoceptors
Reactome
Amine ligand-binding receptors
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (i) signalling events
Name
Explore in Pharos
Explore in Source
Adrenaline signalling through Alpha-2 adrenergic receptor
Adrenoceptors
Amine ligand-binding receptors
Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
Protein-Protein Interactions (317)
1 – 10 of 317
NPY
Tbio
Novelty: 0.00014761
Score: 0.965
Data Source: STRINGDB
POMC
Tbio
Novelty: 0.00002654
Score: 0.956
Data Source: STRINGDB
KNG1
Tchem
Novelty: 0.00008572
Score: 0.955
Data Source: STRINGDB
GNAI2
Tbio
Novelty: 0.04542644
Score: 0.947
Data Source: STRINGDB
GABBR1
Tclin
Family: GPCR
Novelty: 0.00136121
Score: 0.943
Data Source: STRINGDB
SST
Tbio
Novelty: 0.0000732
Score: 0.943
Data Source: STRINGDB
AGTR2
Tchem
Family: GPCR
Novelty: 0.00064305
Score: 0.941
Data Source: STRINGDB
GAL
Tbio
Novelty: 0.00057698
Score: 0.937
Data Source: STRINGDB
GNB3
Tbio
Novelty: 0.0043523
Score: 0.936
Data Source: STRINGDB
PDYN
Tbio
Novelty: 0.00033852
Score: 0.935
Data Source: STRINGDB
Publication Statistics
PubMed Score  949.70

PubMed score by year
PubTator Score  149.75

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSL
1-70
ANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIA
70-140
AVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAK
140-210
GGPGQGESKQPRPDHGGALASAKLPALASVASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNS
210-280
GQGQKEGVCGASPEDEAEEEEEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVG
280-350
AIGGQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
350-420
LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
420-450
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASVASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEEEEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAFRRILCRPWTQTAW