You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
EPHX1
Epoxide hydrolase 1

Protein Summary
Description
Biotransformation enzyme that catalyzes the hydrolysis of arene and aliphatic epoxides to less reactive and more water soluble dihydrodiols by the trans addition of water (By similarity). May play a role in the metabolism of endogenous lipids such as epoxide-containing fatty acids (PubMed:22798687). Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000272167
  • ENSP00000272167
  • ENSG00000143819
  • ENST00000366837
  • ENSP00000355802
  • ENST00000614058
  • ENSP00000480004

Symbol
  • EPHX
  • EPOX
  • MEH
  • EPHX
  • EPOX
  • HYL1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
chemical
0.97
gene perturbation
0.91
biological term
0.84
disease
0.84
disease perturbation
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 504.28   (req: < 5)
Gene RIFs: 166   (req: <= 3)
Antibodies: 382   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 504.28   (req: >= 5)
Gene RIFs: 166   (req: > 3)
Antibodies: 382   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 157
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
triclocarban
chemical structure image
Active Ligands (157)
1 – 10 of 157
CHEMBL436774
chemical structure image
CHEMBL214943
chemical structure image
CHEMBL3263303
chemical structure image
CHEMBL242255,CHEMBL516415
chemical structure image
CHEMBL217758
chemical structure image
CHEMBL3661340,CHEMBL67158
chemical structure image
CHEMBL215121
chemical structure image
CHEMBL215908
chemical structure image
Pathways (11)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Metabolism
Reactome
Phase I - Functionalization of compounds
Name
Explore in Pharos
Explore in Source
Biological oxidations
Metabolism
Phase I - Functionalization of compounds
Protein-Protein Interactions (123)
1 – 10 of 123
RAB34
Tbio
Family: Enzyme
Novelty: 0.01573742
p_int: 0.999998577
p_ni: 0.000001423
Score: 0.243
Data Source: BioPlex,STRINGDB
MFSD8
Tbio
Novelty: 0.01280168
p_int: 0.999997318
p_ni: 0.000002682
Data Source: BioPlex
SPINT2
Tbio
Family: Enzyme
Novelty: 0.00575409
p_int: 0.988541509
p_ni: 0.011458489
p_wrong: 2e-9
Data Source: BioPlex
KCNS3
Tclin
Family: IC
Novelty: 0.08293831
p_int: 0.980255452
p_ni: 0.019744548
Data Source: BioPlex
TRAF1
Tbio
Novelty: 0.00703177
p_int: 0.979866868
p_ni: 0.020133126
p_wrong: 6e-9
Data Source: BioPlex
SRPRB
Tbio
Novelty: 0.03850629
p_int: 0.952072956
p_ni: 0.047927044
Data Source: BioPlex
RXFP1
Tchem
Family: GPCR
Novelty: 0.00590091
p_int: 0.949466019
p_ni: 0.050533981
Data Source: BioPlex
TSPAN17
Tdark
Novelty: 0.52282158
p_int: 0.948751816
p_ni: 0.051248184
Score: 0.159
Data Source: BioPlex,STRINGDB
PCDHGB4
Tdark
Novelty: 0.62001206
p_int: 0.932189188
p_ni: 0.067810812
Data Source: BioPlex
PCDHGA5
Tdark
p_int: 0.909807475
p_ni: 0.090192524
p_wrong: 1e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  504.28

PubMed score by year
PubTator Score  343.76

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKF
1-70
RFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHT
70-140
PKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYK
140-210
LMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVE
210-280
LLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFS
280-350
LDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKL
350-420
ISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ
420-455
MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVELLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFSLDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ