You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CYSLTR1
Cysteinyl leukotriene receptor 1

Protein Summary
Description
Receptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4. This gene encodes a member of the G-protein coupled receptor 1 family. The encoded protein is a receptor for cysteinyl leukotrienes, and is involved in mediating bronchoconstriction via activation of a phosphatidylinositol-calcium second messenger system. Activation of the encoded receptor results in contraction and proliferation of bronchial smooth muscle cells, eosinophil migration, and damage to the mucus layer in the lung. Upregulation of this gene is associated with asthma and dysregulation may also be implicated in cancer. Alternativ ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373304
  • ENSP00000362401
  • ENSG00000173198
  • ENST00000614798
  • ENSP00000478492

Symbol
  • CYSLT1
  • CYSLT1
  • CYSLTR
  • CYSLT1R
  • HMTMF81
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.7
ligand (chemical)
0.66
tissue sample
0.62
chemical
0.6
gene perturbation
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 391.07   (req: < 5)
Gene RIFs: 61   (req: <= 3)
Antibodies: 295   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 391.07   (req: >= 5)
Gene RIFs: 61   (req: > 3)
Antibodies: 295   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 97
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Active Ligands (97)
1 – 10 of 97
LTD<sub>4</sub>
chemical structure image
LTE<sub>4</sub>
chemical structure image
BAYu9773
chemical structure image
CHEMBL22776
chemical structure image
CHEMBL280481,CHEMBL89340
chemical structure image
CHEMBL288943
chemical structure image
LTC<sub>4</sub>
chemical structure image
Pathways (12)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
Eicosanoid ligand-binding receptors
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
Eicosanoid ligand-binding receptors
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Protein-Protein Interactions (197)
1 – 10 of 197
TBXA2R
Tclin
Family: GPCR
Novelty: 0.00629658
Score: 0.945
Data Source: STRINGDB
CYSLTR2
Tchem
Family: GPCR
Novelty: 0.00930645
Score: 0.944
Data Source: STRINGDB
PTGER1
Tclin
Family: GPCR
Novelty: 0.00206493
Score: 0.941
Data Source: STRINGDB
GPR17
Tchem
Family: GPCR
Novelty: 0.00385905
Score: 0.937
Data Source: STRINGDB
LTB4R2
Tchem
Family: GPCR
Novelty: 0.01331761
Score: 0.933
Data Source: STRINGDB
LTB4R
Tchem
Family: GPCR
Novelty: 0.00174481
Score: 0.924
Data Source: STRINGDB
TAC1
Tbio
Novelty: 0.00007711
Score: 0.923
Data Source: STRINGDB
ANXA1
Tbio
Novelty: 0.00120306
Score: 0.919
Data Source: STRINGDB
KNG1
Tchem
Novelty: 0.00008572
Score: 0.918
Data Source: STRINGDB
GPR143
Tbio
Family: GPCR
Novelty: 0.01765091
Score: 0.918
Data Source: STRINGDB
Publication Statistics
PubMed Score  391.07

PubMed score by year
PubTator Score  269.56

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADL
1-70
LCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKA
70-140
RFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYT
140-210
MIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVIT
210-280
LSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
280-337
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV