You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ELOC
Elongin-C

Protein Summary
Description
SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed:7821821). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity). The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RB ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000284811
  • ENSP00000284811
  • ENSG00000154582
  • ENST00000518127
  • ENSP00000428334
  • ENST00000519487
  • ENSP00000429596
  • ENST00000520210
  • ENSP00000430224
  • ENST00000520242
  • ENSP00000428171
  • ENST00000522337
  • ENSP00000429906
  • ENST00000523815
  • ENSP00000428074
  • ENST00000622804
  • ENSP00000478121

Symbol
  • TCEB1
  • SIII
  • TCEB1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 56.21   (req: < 5)
Gene RIFs: 20   (req: <= 3)
Antibodies: 229   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 56.21   (req: >= 5)
Gene RIFs: 20   (req: > 3)
Antibodies: 229   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (56)
1 – 5 of 56
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (48)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 39
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen processing: Ubiquitination & Proteasome degradation
Reactome
Axon guidance
Reactome
Cellular response to hypoxia
Reactome
Cellular responses to external stimuli
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen processing: Ubiquitination & Proteasome degradation
Axon guidance
Cellular response to hypoxia
Cellular responses to external stimuli
Gene Ontology Terms (12)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (517)
1 – 10 of 517
ASB9
Tbio
Novelty: 0.18287144
p_int: 0.999340186
p_ni: 0.000659814
Score: 0.995
Data Source: BioPlex,STRINGDB
VHL
Tchem
Family: Enzyme
Novelty: 0.00323188
p_int: 0.999126815
p_ni: 0.000873185
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
ANKRD9
Tdark
Novelty: 0.4990099
p_int: 0.997528493
p_ni: 0.002471507
Score: 0.907
Data Source: BioPlex,STRINGDB
NRBP1
Tbio
Family: Kinase
Novelty: 0.08101852
p_int: 0.993633975
p_ni: 0.006366025
Score: 0.474
Data Source: BioPlex,STRINGDB
RAB40B
Tbio
Novelty: 0.31608904
p_int: 0.990959475
p_ni: 0.009040525
Score: 0.891
Data Source: BioPlex,STRINGDB
KLHDC2
Tbio
Novelty: 0.02314409
p_int: 0.990606725
p_ni: 0.009393275
Score: 0.323
Data Source: BioPlex,STRINGDB
ASB6
Tdark
Novelty: 0.47244094
p_int: 0.973498175
p_ni: 0.026501825
Score: 0.947
Data Source: BioPlex,STRINGDB
ELOA2
Tdark
Family: Enzyme
Novelty: 0.85714286
p_int: 0.966450944
p_ni: 0.033549056
Score: 0.991
Data Source: BioPlex,Reactome,STRINGDB
RAB40A
Tdark
Novelty: 0.19230769
p_int: 0.931934262
p_ni: 0.068065738
Score: 0.889
Data Source: BioPlex,STRINGDB
ASB3
Tdark
Novelty: 0.29666183
p_int: 0.912802143
p_ni: 0.087197857
Score: 0.601
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  56.21

PubMed score by year
PubTator Score  53.03

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVL
1-70
SKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
70-112
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC