You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
GGTLC3
Putative glutathione hydrolase light chain 3

Protein Classes
Protein Summary
Description
Gamma-glutamyltransferase-1 (GGT1; MIM 612346) is a membrane-bound extracellular enzyme that cleaves gamma-glutamyl peptide bonds in glutathione and other peptides and transfers the gamma-glutamyl moiety to acceptors. Autocatalytic cleavage of the GGT1 precursor polypeptide produces a heavy chain and a light chain that associate with each other to form the functional enzyme. Light chain-only GGTs, such as GGTLC3, contain a region corresponding to the GGT1 light chain, but they lack the membrane-anchoring heavy chain region (Heisterkamp et al., 2008 [PubMed 18357469]).[supplied by OMIM, Oct 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000619998
  • ENSP00000477856
  • ENSG00000274252

Symbol
  • GGT
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.98
cellular component
0.72
cell line
0.71
tissue
0.44
PubMedID
0.17


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1167.07   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 5   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1167.07   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 5   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (163)
1 – 10 of 163
GPT
Tbio
Family: Enzyme
Novelty: 0.00005555
Score: 0.894
Data Source: STRINGDB
GAPDH
Tchem
Family: Enzyme
Novelty: 0.00019506
Score: 0.819
Data Source: STRINGDB
ALB
Tchem
Novelty: 0.0000092
Score: 0.806
Data Source: STRINGDB
GGCT
Tchem
Family: Enzyme
Novelty: 0.0017048
Score: 0.751
Data Source: STRINGDB
PLOD3
Tbio
Family: Enzyme
Novelty: 0.02714169
Score: 0.748
Data Source: STRINGDB
LOXL1
Tbio
Family: Enzyme
Novelty: 0.00259798
Score: 0.746
Data Source: STRINGDB
AGA
Tbio
Family: Enzyme
Novelty: 0.00247664
Score: 0.733
Data Source: STRINGDB
HPGDS
Tchem
Family: Enzyme
Novelty: 0.00017173
Score: 0.722
Data Source: STRINGDB
ATF1
Tchem
Family: TF
Novelty: 0.01654271
Score: 0.717
Data Source: STRINGDB
SUGCT
Tbio
Family: Enzyme
Novelty: 0.00434103
Score: 0.71
Data Source: STRINGDB
Publication Statistics
PubMed Score  1167.07

PubMed score by year
PubTator Score  208.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSG
1-70
ILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCPTIMVGQDGQVRMVVGAAGGTQITTDTALA
70-140
IIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGW
140-210
AAASDSRKGGEPAGY
210-225
MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCPTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY