You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HADH
Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial

Protein Summary
Description
Plays an essential role in the mitochondrial beta-oxidation of short chain fatty acids. Exerts it highest activity toward 3-hydroxybutyryl-CoA. This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene of this gene on chromosome 15. [provided by RefSeq, May 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000309522
  • ENSP00000312288
  • ENSG00000138796
  • ENST00000603302
  • ENSP00000474560

Symbol
  • HAD
  • HADHSC
  • SCHAD
  • HAD
  • HCDH
  • HHF4
  • HADH1
  • SCHAD
  • HADHSC
  • MSCHAD
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
transcription factor perturbation
1
virus perturbation
0.94
protein domain
0.92
kinase perturbation
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 270.78   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 496   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 270.78   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 496   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (12)
1 – 5 of 12
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (30)
Beta oxidation of butanoyl-CoA to acetyl-CoA (R-HSA-77352)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Beta oxidation of butanoyl-CoA to acetyl-CoA
Reactome
Beta oxidation of decanoyl-CoA to octanoyl-CoA-CoA
Reactome
Beta oxidation of hexanoyl-CoA to butanoyl-CoA
Reactome
Beta oxidation of lauroyl-CoA to decanoyl-CoA-CoA
Reactome
Beta oxidation of octanoyl-CoA to hexanoyl-CoA
Name
Explore in Pharos
Explore in Source
Beta oxidation of butanoyl-CoA to acetyl-CoA
Beta oxidation of decanoyl-CoA to octanoyl-CoA-CoA
Beta oxidation of hexanoyl-CoA to butanoyl-CoA
Beta oxidation of lauroyl-CoA to decanoyl-CoA-CoA
Beta oxidation of octanoyl-CoA to hexanoyl-CoA
Gene Ontology Terms (12)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (177)
1 – 10 of 177
ECHS1
Tbio
Family: Enzyme
Novelty: 0.01956365
Score: 0.997
Data Source: STRINGDB
ACAA1
Tbio
Family: Enzyme
Novelty: 0.00482727
Score: 0.995
Data Source: STRINGDB
HADHB
Tbio
Family: Enzyme
Novelty: 0.01003327
Score: 0.995
Data Source: STRINGDB
ACAT1
Tchem
Family: Enzyme
Novelty: 0.01281956
Score: 0.991
Data Source: STRINGDB
ACAT2
Tchem
Family: Enzyme
Novelty: 0.01744566
Score: 0.991
Data Source: STRINGDB
ACAA2
Tbio
Family: Enzyme
Novelty: 0.02112232
Score: 0.989
Data Source: STRINGDB
ACADM
Tbio
Family: Enzyme
Novelty: 0.00590747
Score: 0.975
Data Source: STRINGDB
SCP2
Tchem
Novelty: 0.00215179
Score: 0.974
Data Source: STRINGDB
ALDH6A1
Tbio
Family: Enzyme
Novelty: 0.05651741
Score: 0.971
Data Source: STRINGDB
OXCT1
Tbio
Family: Enzyme
Novelty: 0.0035774
Score: 0.956
Data Source: STRINGDB
Publication Statistics
PubMed Score  270.78

PubMed score by year
PubTator Score  91.58

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGI
1-70
EESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAE
70-140
HTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVS
140-210
CKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEM
210-280
DAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
280-314
MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK