You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MAGEA3
Melanoma-associated antigen 3

Protein Summary
Description
Proposed to enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. May enhance ubiquitin ligase activity of TRIM28 and stimulate p53/TP53 ubiquitination by TRIM28. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. May play a role in embryonal development and tumor transformation or aspects of tumor progression. In vitro promotes cell viability in melanoma cell lines. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000370278
  • ENSP00000359301
  • ENSG00000221867
  • ENST00000598245
  • ENSP00000473093

Symbol
  • MAGE3
  • HIP8
  • HYPD
  • CT1.3
  • MAGE3
  • MAGEA6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.64
small molecule perturbation
0.61
PubMedID
0.53
disease
0.5
chemical
0.42


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 315.99   (req: < 5)
Gene RIFs: 64   (req: <= 3)
Antibodies: 396   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 315.99   (req: >= 5)
Gene RIFs: 64   (req: > 3)
Antibodies: 396   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
ParkinsonsUK-UCL
Protein-Protein Interactions (89)
1 – 10 of 89
GAGE2A
Tdark
Novelty: 1.8757762
Score: 0.907
Data Source: STRINGDB
CSAG1
Tdark
Novelty: 0.32876712
Score: 0.9
Data Source: STRINGDB
GAGE12F
Tdark
Novelty: 0.03195393
Score: 0.89
Data Source: STRINGDB
GAGE12I
Tbio
Novelty: 0.03195393
Score: 0.89
Data Source: STRINGDB
BAGE3
Tdark
Novelty: 0.03399018
Score: 0.882
Data Source: STRINGDB
BAGE2
Tdark
Novelty: 0.03399018
Score: 0.882
Data Source: STRINGDB
BAGE5
Tdark
Novelty: 0.03399018
Score: 0.882
Data Source: STRINGDB
CTAG1A
Tbio
Novelty: 0.0037756
Score: 0.873
Data Source: STRINGDB
GAGE4
Tbio
Novelty: 0.12404497
Score: 0.839
Data Source: STRINGDB
GAGE1
Tdark
Novelty: 0.12404497
Score: 0.839
Data Source: STRINGDB
Publication Statistics
PubMed Score  315.99

PubMed score by year
PubTator Score  324.35

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASS
1-70
LPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVV
70-140
GNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIA
140-210
REGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVE
210-280
TSYVKVLHHMVKISGGPHISYPPLHEWVLREGEE
280-314
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHMVKISGGPHISYPPLHEWVLREGEE