You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
FPR2
N-formyl peptide receptor 2

Protein Summary
Description
Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophil chemotactic factors (PubMed:1374236). Binding of FMLP to the receptor causes activation of neutrophils (PubMed:1374236). This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system (PubMed:1374236). The activation of LXA4R could result in an anti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4) (PubMed:9547339). Receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000340023
  • ENSP00000340191
  • ENSG00000171049
  • ENST00000598776
  • ENSP00000468897
  • ENST00000598953
  • ENSP00000468876

Symbol
  • FPRH1
  • FPRL1
  • LXA4R
  • ALXR
  • HM63
  • FMLPX
  • FPR2A
  • FPRH1
  • FPRH2
  • FPRL1
  • LXA4R
  • FMLP-R-II
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
ligand (protein)
0.95
ligand (chemical)
0.94
gene perturbation
0.76
microRNA
0.76
phenotype
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 387.86   (req: < 5)
Gene RIFs: 97   (req: <= 3)
Antibodies: 373   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 387.86   (req: >= 5)
Gene RIFs: 97   (req: > 3)
Antibodies: 373   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 37
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (17)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
Formyl peptide receptors bind formyl peptides and many other ligands
Reactome
G alpha (i) signalling events
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
Formyl peptide receptors bind formyl peptides and many other ligands
G alpha (i) signalling events
G alpha (q) signalling events
GPCR downstream signalling
Protein-Protein Interactions (579)
1 – 10 of 579
FUNDC2
Tbio
Novelty: 0.19216105
p_int: 0.99996438
p_ni: 0.000035608
p_wrong: 1.2e-8
Data Source: BioPlex
REEP6
Tbio
Novelty: 0.17493781
p_int: 0.999936527
p_ni: 0.000063473
Data Source: BioPlex
ATP2B3
Tbio
Family: Transporter
Novelty: 0.00284831
p_int: 0.999578057
p_ni: 0.000421943
Data Source: BioPlex
SLC38A9
Tbio
Family: Transporter
Novelty: 0.11535293
p_int: 0.999464393
p_ni: 0.000514957
p_wrong: 0.000020651
Data Source: BioPlex
FNDC3A
Tbio
Novelty: 0.00427151
p_int: 0.999365057
p_ni: 0.000634803
p_wrong: 1.39e-7
Data Source: BioPlex
SLC30A5
Tbio
Family: Transporter
Novelty: 0.03895139
p_int: 0.998917023
p_ni: 0.001082977
Data Source: BioPlex
RRAGB
Tbio
Novelty: 0.03689523
p_int: 0.998789392
p_ni: 0.001207518
p_wrong: 0.00000309
Data Source: BioPlex
ELOVL2
Tbio
Novelty: 0.00954519
p_int: 0.998617442
p_ni: 0.001323078
p_wrong: 0.00005948
Data Source: BioPlex
ATP2B4
Tbio
Family: Transporter
Novelty: 0.00694066
p_int: 0.998086371
p_ni: 0.001913629
Score: 0.165
Data Source: BioPlex,STRINGDB
DOLK
Tbio
Family: Enzyme
Novelty: 0.01235495
p_int: 0.996482621
p_ni: 0.003154789
p_wrong: 0.000362589
Data Source: BioPlex
Publication Statistics
PubMed Score  387.86

PubMed score by year
PubTator Score  286.8

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALA
1-70
DFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVS
70-140
LAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGF
140-210
SLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKII
210-280
DILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQA
280-350
M
350-351
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM