You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
NMT1
Glycylpeptide N-tetradecanoyltransferase 1

Protein Classes
Protein Summary
Description
Adds a myristoyl group to the N-terminal glycine residue of certain cellular and viral proteins. Myristate, a rare 14-carbon saturated fatty acid, is cotranslationally attached by an amide linkage to the N-terminal glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase (NMT; EC 2.3.1.97) catalyzes the transfer of myristate from CoA to proteins. N-myristoylation appears to be irreversible and is required for full expression of the biologic activities of several N-myristoylated proteins, including the alpha subunit of the signal-transducing guanine nucleotide-binding protein (G protein) GO (GNAO1; MIM 139311) (Duronio et al., 1992 [PubMed 1570339]).[supplied by OMIM, Nov 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000258960
  • ENSP00000258960
  • ENSG00000136448
  • ENST00000592782
  • ENSP00000468424

Symbol
  • NMT
  • NMT
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
virus perturbation
1
kinase perturbation
0.84
transcription factor binding site profile
0.83
transcription factor perturbation
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 236.04   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 178   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 236.04   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 178   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 205
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (205)
1 – 10 of 205
CHEMBL1230468,CHEMBL3942428
chemical structure image
CHEMBL3358114
chemical structure image
CHEMBL3357687,CHEMBL3900458
chemical structure image
CHEMBL3899382,CHEMBL3357693
chemical structure image
CHEMBL3357686,CHEMBL3909978
chemical structure image
CHEMBL3358112
chemical structure image
CHEMBL3357702
chemical structure image
CHEMBL3892644,CHEMBL3913730
chemical structure image
CHEMBL3357696,CHEMBL3949562
chemical structure image
CHEMBL3357703
chemical structure image
Protein Data Bank (16)
1 – 5 of 16
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (16)
Activation, myristolyation of BID and translocation to mitochondria (R-HSA-75108)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation, myristolyation of BID and translocation to mitochondria
Reactome
Apoptosis
Reactome
Disease
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Name
Explore in Pharos
Explore in Source
Activation, myristolyation of BID and translocation to mitochondria
Apoptosis
Disease
G alpha (i) signalling events
GPCR downstream signalling
Protein-Protein Interactions (91)
1 – 10 of 91
CHURC1
Tbio
Novelty: 0.00494162
p_int: 0.999420116
p_ni: 0.000579884
Data Source: BioPlex
GPRC5C
Tdark
Family: GPCR
Novelty: 0.19417476
p_int: 0.999349867
p_ni: 0.000650133
Data Source: BioPlex
NCS1
Tbio
Novelty: 0.00364462
p_int: 0.999150144
p_ni: 0.000849856
Score: 0.286
Data Source: BioPlex,STRINGDB
MARCKSL1
Tbio
Novelty: 0.01663716
p_int: 0.997723288
p_ni: 0.002276712
Data Source: BioPlex
AIFM3
Tbio
Novelty: 0.22929936
p_int: 0.994417826
p_ni: 0.005582174
Score: 0.391
Data Source: BioPlex,STRINGDB
TGFB1
Tchem
Novelty: 0.00014007
p_int: 0.992551132
p_ni: 0.007448868
Score: 0.175
Data Source: BioPlex,STRINGDB
TLDC1
Tdark
p_int: 0.980144756
p_ni: 0.019855244
Score: 0.221
Data Source: BioPlex,STRINGDB
ABLIM1
Tbio
Novelty: 0.07133614
p_int: 0.979166058
p_ni: 0.020833942
Score: 0.21
Data Source: BioPlex,STRINGDB
ANGPTL7
Tbio
Novelty: 0.04098144
p_int: 0.975727712
p_ni: 0.024272288
Score: 0.183
Data Source: BioPlex,STRINGDB
UBTD1
Tdark
Novelty: 1.15384615
p_int: 0.970019294
p_ni: 0.029980706
Data Source: BioPlex
Publication Statistics
PubMed Score  236.04

PubMed score by year
PubTator Score  186.72

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSE
1-70
TDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEP
70-140
DKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQW
140-210
HCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAV
210-280
YTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVH
280-350
QLLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAY
350-420
SFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEK
420-490
VGLVLQ
490-496
MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ