You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
PIP5K1C
Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma

Protein Summary
Description
Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns4P) to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). PtdIns(4,5)P2 is involved in a variety of cellular processes and is the substrate to form phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3), another second messenger. The majority of PtdIns(4,5)P2 is thought to occur via type I phosphatidylinositol 4-phosphate 5-kinases given the abundance of PtdIns4P. Participates in a variety of cellular processes such as vesicle mediated transport, cell adhesion, cell polarization and cell migration. Together with PIP5K1A is required for phagocytosis, but they regulate different types of actin remodeling at sequential steps. Promotes particle attachment by generating the pool of PtdIns(4,5)P2 that induces controlled actin depolymerization to facilitate Fc-gamma-R clustering. Mediates RAC1-dependent reorganization of actin filaments. Required for synaptic vesicle transport. Controls the plasma membrane p ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000335312
  • ENSP00000335333
  • ENSG00000186111
  • ENST00000537021
  • ENSP00000444779
  • ENST00000539785
  • ENSP00000445992
  • ENST00000589578
  • ENSP00000466363

Symbol
  • KIAA0589
  • LCCS3
  • PIP5Kgamma
  • PIP5K-GAMMA
  • PIP5K1-gamma
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.94
transcription factor binding site profile
0.75
protein domain
0.73
biological process
0.7
pathway
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.43   (req: < 5)
Gene RIFs: 35   (req: <= 3)
Antibodies: 218   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.43   (req: >= 5)
Gene RIFs: 35   (req: > 3)
Antibodies: 218   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL1241674
chemical structure image
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (42)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 17
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Clathrin-mediated endocytosis
Reactome
Developmental Biology
Reactome
Intracellular signaling by second messengers
Reactome
Membrane Trafficking
Name
Explore in Pharos
Explore in Source
Axon guidance
Clathrin-mediated endocytosis
Developmental Biology
Intracellular signaling by second messengers
Membrane Trafficking
Protein-Protein Interactions (120)
1 – 10 of 120
PIP5K1A
Tbio
Family: Kinase
Novelty: 0.08213456
p_int: 0.999999112
p_ni: 4e-9
p_wrong: 8.85e-7
Score: 0.963
Data Source: BioPlex,STRINGDB
RABGGTB
Tbio
Family: Enzyme
Novelty: 0.13346044
p_int: 0.999995354
p_ni: 1.5e-8
p_wrong: 0.000004631
Score: 0.66
Data Source: BioPlex,STRINGDB
TLN1
Tbio
Novelty: 0.00988479
Score: 0.996
Data Source: Reactome,STRINGDB
ARF6
Tbio
Family: Enzyme
Novelty: 0.00305495
Score: 0.982
Data Source: STRINGDB
PI4KA
Tchem
Family: Kinase
Novelty: 0.02976615
Score: 0.968
Data Source: STRINGDB
PI4KB
Tchem
Family: Kinase
Novelty: 0.01238722
Score: 0.967
Data Source: STRINGDB
TLN2
Tbio
Novelty: 0.0383066
Score: 0.963
Data Source: STRINGDB
PIK3CD
Tclin
Family: Kinase
Novelty: 0.0044215
Score: 0.952
Data Source: STRINGDB
SACM1L
Tbio
Family: Enzyme
Novelty: 0.00847665
Score: 0.942
Data Source: STRINGDB
CDH1
Tbio
Novelty: 0.0001303
Score: 0.94
Data Source: STRINGDB
Publication Statistics
PubMed Score  24.43

PubMed score by year
PubTator Score  13.03

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEVLSMTAQPGPGHGKKLGHRGVDASGETT
1-70
YKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFQDFRFKTYAPVA
70-140
FRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVTSDDEFIIKTVMHKEAEFLQKLLPGYYMNLN
140-210
QNPRTLLPKFYGLYCVQSGGKNIRVVVMNNILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDF
210-280
MQDMPEGLLLDADTFSALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGAQSTSDEKRPVGQ
280-350
KALYSTAMESIQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
350-420
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQIPSEREEAQYD
420-490
LRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPSETSEQPRYRRRTQSSGQDG
490-560
RPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEASPAGASAAVEVETASQASDEEGAPASQASDE
560-630
EDAPATDIYFPTDERSWVYSPLHYSAQAPPASDGESDT
630-668
MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEVLSMTAQPGPGHGKKLGHRGVDASGETTYKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVTSDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNNILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDFMQDMPEGLLLDADTFSALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGAQSTSDEKRPVGQKALYSTAMESIQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDGDTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQIPSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPSETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEASPAGASAAVEVETASQASDEEGAPASQASDEEDAPATDIYFPTDERSWVYSPLHYSAQAPPASDGESDT