You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MPPE1
Metallophosphoesterase 1

Protein Summary
Description
Metallophosphoesterase required for transport of GPI-anchor proteins from the endoplasmic reticulum to the Golgi. Acts in lipid remodeling steps of GPI-anchor maturation by mediating the removal of a side-chain ethanolamine-phosphate (EtNP) from the second Man (Man2) of the GPI intermediate, an essential step for efficient transport of GPI-anchor proteins.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000309976
  • ENSP00000311200
  • ENSG00000154889
  • ENST00000317235
  • ENSP00000327257
  • ENST00000496196
  • ENSP00000433950
  • ENST00000588072
  • ENSP00000465894

Symbol
  • PGAP5
  • PGAP5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.83
virus perturbation
0.76
cell type or tissue
0.73
molecular function
0.7
cellular component
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.91   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 128   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.91   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 128   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (13)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Protein-Protein Interactions (112)
1 – 10 of 112
EDEM1
Tbio
Family: Enzyme
Novelty: 0.01709827
p_int: 0.999979342
p_ni: 0.000020658
Data Source: BioPlex
ICAM4
Tbio
Novelty: 0.03417897
p_int: 0.999961634
p_ni: 0.000038238
p_wrong: 1.29e-7
Score: 0.187
Data Source: BioPlex,STRINGDB
TMEM186
Tdark
Novelty: 3
p_int: 0.999885931
p_ni: 0.000114069
Data Source: BioPlex
UGT3A2
Tbio
Family: Enzyme
Novelty: 1.37837838
p_int: 0.999869627
p_ni: 0.000091131
p_wrong: 0.000039242
Data Source: BioPlex
GINM1
Tdark
p_int: 0.999712957
p_ni: 0.000222004
p_wrong: 0.000065039
Data Source: BioPlex
PIGB
Tbio
Family: Enzyme
Novelty: 0.04150533
p_int: 0.999689441
p_ni: 0.000096685
p_wrong: 0.000213874
Score: 0.437
Data Source: BioPlex,STRINGDB
SEMA6A
Tbio
Novelty: 0.0073015
p_int: 0.999673991
p_ni: 0.000325991
p_wrong: 1.8e-8
Score: 0.292
Data Source: BioPlex,STRINGDB
TMEM59L
Tbio
Novelty: 0.08727273
p_int: 0.999421563
p_ni: 0.000577702
p_wrong: 7.35e-7
Data Source: BioPlex
GALNT4
Tbio
Family: Enzyme
Novelty: 0.06117644
p_int: 0.999400664
p_ni: 0.00016486
p_wrong: 0.000434476
Score: 0.171
Data Source: BioPlex,STRINGDB
DHFR2
Tbio
Family: Enzyme
Novelty: 0.03421403
p_int: 0.999375393
p_ni: 0.000603158
p_wrong: 0.000021449
Data Source: BioPlex
Publication Statistics
PubMed Score  3.91

PubMed score by year
PubTator Score  5.92

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAMIELGFGRQNFHPLKRKSSLLLKLIAVVFAVLLFCEFLIYYLAIFQCNWPEVKTTASDGEQTTREPVL
1-70
KAMFLADTHLLGEFLGHWLDKLRREWQMERAFQTALWLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQ
70-140
KMFRHPSHVQLKVVAGNHDIGFHYEMNTYKVERFEKVFSSERLFSWKGINFVMVNSVALNGDGCGICSET
140-210
EAELIEVSHRLNCSREARGSSRCGPGPLLPTSAPVLLQHYPLYRRSDANCSGEDAAPAEERDIPFKENYD
210-280
VLSREASQKLLWWLQPRLVLSGHTHSACEVHHGGRVPELSVPSFSWRNRNNPSFIMGSITPTDYTLSKCY
280-350
LPREDVVLIIYCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR
350-396
MAMIELGFGRQNFHPLKRKSSLLLKLIAVVFAVLLFCEFLIYYLAIFQCNWPEVKTTASDGEQTTREPVLKAMFLADTHLLGEFLGHWLDKLRREWQMERAFQTALWLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAGNHDIGFHYEMNTYKVERFEKVFSSERLFSWKGINFVMVNSVALNGDGCGICSETEAELIEVSHRLNCSREARGSSRCGPGPLLPTSAPVLLQHYPLYRRSDANCSGEDAAPAEERDIPFKENYDVLSREASQKLLWWLQPRLVLSGHTHSACEVHHGGRVPELSVPSFSWRNRNNPSFIMGSITPTDYTLSKCYLPREDVVLIIYCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR