You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PTRH2
Peptidyl-tRNA hydrolase 2, mitochondrial

Protein Summary
Description
The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis. Promotes caspase-independent apoptosis by regulating the function of two transcriptional regulators, AES and TLE1. The protein encoded by this gene is a mitochondrial protein with two putative domains, an N-terminal mitochondrial localization sequence, and a UPF0099 domain. In vitro assays suggest that this protein possesses peptidyl-tRNA hydrolase activity, to release the peptidyl moiety from tRNA, thereby preventing the accumulation of dissociated peptidyl-tRNA that could reduce the efficiency of translation. This protein also plays a role regulating cell survival and death. It promotes survival as part of an integrin-signaling pathway for cells attached to the extracellular matrix (ECM), but also promotes apoptosis in cells that have lost their attachment to the ECM, a process called anoikos. After loss of cell attachment to the ECM, this protein is phosphorylated, is re ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000393038
  • ENSP00000376758
  • ENSG00000141378
  • ENST00000470557
  • ENSP00000464327

Symbol
  • BIT1
  • PTH2
  • PTH
  • BIT1
  • PTH2
  • PTH 2
  • CFAP37
  • IMNEPD
  • CGI-147
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.99
histone modification site profile
0.84
interacting protein
0.83
transcription factor binding site profile
0.82
disease perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 29.42   (req: < 5)
Gene RIFs: 20   (req: <= 3)
Antibodies: 335   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 29.42   (req: >= 5)
Gene RIFs: 20   (req: > 3)
Antibodies: 335   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (64)
Deubiquitination (R-HSA-5688426)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Deubiquitination
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Reactome
Ub-specific processing proteases
Name
Explore in Pharos
Explore in Source
Deubiquitination
Metabolism of proteins
Post-translational protein modification
Ub-specific processing proteases
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
CAFA
Protein-Protein Interactions (103)
1 – 10 of 103
EVA1B
Tdark
Novelty: 3
p_int: 0.999663047
p_ni: 0.000336938
p_wrong: 1.4e-8
Data Source: BioPlex
TLR5
Tbio
Novelty: 0.00082816
p_int: 0.999235339
p_ni: 0.000764661
Data Source: BioPlex
MINDY2
Tbio
Novelty: 0.5060241
p_int: 0.989215673
p_ni: 0.010784316
p_wrong: 1e-8
Score: 0.155
Data Source: BioPlex,STRINGDB
CHRM3
Tclin
Family: GPCR
Novelty: 0.00207684
p_int: 0.976942568
p_ni: 0.023057431
p_wrong: 1e-9
Data Source: BioPlex
CD7
Tbio
Novelty: 0.00139631
p_int: 0.975174131
p_ni: 0.024825813
p_wrong: 5.6e-8
Score: 0.219
Data Source: BioPlex,STRINGDB
SLC6A15
Tchem
Family: Transporter
Novelty: 0.01744012
p_int: 0.942306186
p_ni: 0.057693813
p_wrong: 1e-9
Data Source: BioPlex
HTR2C
Tclin
Family: GPCR
Novelty: 0.00077672
p_int: 0.934644693
p_ni: 0.065355258
p_wrong: 4.9e-8
Data Source: BioPlex
CLEC5A
Tbio
Novelty: 0.0230333
p_int: 0.899936853
p_ni: 0.100063081
p_wrong: 6.6e-8
Data Source: BioPlex
TNFRSF10B
Tbio
Novelty: 0.0006573
p_int: 0.89735811
p_ni: 0.102641889
Data Source: BioPlex
SIGLEC10
Tbio
Novelty: 0.07369696
p_int: 0.884587146
p_ni: 0.115325508
p_wrong: 0.000087345
Score: 0.157
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  29.42

PubMed score by year
PubTator Score  18.74

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILV
1-70
VRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTV
70-140
SLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
140-179
MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY