You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GJD3
Gap junction delta-3 protein

Protein Summary
Description
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. This gene is a member of the large family of connexins that are required for the formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexon from a neighboring cell, thus forming a channel linking the cytoplasm of the 2 cells. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000578689
  • ENSP00000463752
  • ENSG00000183153

Symbol
  • GJA11
  • GJC1
  • GJC1
  • GJA11
  • CX31.9
  • Cx30.2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.58
cell line
0.53
tissue sample
0.52
molecular function
0.49
transcription factor binding site profile
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.2   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 31   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.2   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 31   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Gap junction assembly (R-HSA-190861)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gap junction assembly
Reactome
Gap junction trafficking
Reactome
Gap junction trafficking and regulation
Reactome
Membrane Trafficking
Reactome
Vesicle-mediated transport
Name
Explore in Pharos
Explore in Source
Gap junction assembly
Gap junction trafficking
Gap junction trafficking and regulation
Membrane Trafficking
Vesicle-mediated transport
Gene Ontology Terms (9)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (34)
1 – 10 of 34
TJP1
Tbio
Novelty: 0.0005583
Score: 0.873
Data Source: STRINGDB
GJB1
Tbio
Novelty: 0.00115116
Score: 0.757
Data Source: STRINGDB
GJA5
Tbio
Novelty: 0.00254124
Score: 0.747
Data Source: STRINGDB
GJB2
Tbio
Novelty: 0.00063266
Score: 0.739
Data Source: STRINGDB
GJA8
Tbio
Novelty: 0.00138739
Score: 0.737
Data Source: STRINGDB
GJE1
Tdark
Novelty: 0.29459902
Score: 0.713
Data Source: STRINGDB
GJA1
Tbio
Novelty: 0.00023576
Score: 0.598
Data Source: STRINGDB
GJC1
Tbio
Novelty: 0.00506104
Score: 0.592
Data Source: STRINGDB
HCN4
Tclin
Family: IC
Novelty: 0.00301943
Score: 0.584
Data Source: STRINGDB
CDH2
Tbio
Novelty: 0.00055399
Score: 0.497
Data Source: STRINGDB
Publication Statistics
PubMed Score  9.20

PubMed score by year
PubTator Score  4.52

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGEWAFLGSLLDAVQLQSPLVGRLWLVVMLIFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAF
1-70
PVSHYRFWLFHILLLSAPPVLFVVYSMHRAGKEAGGAEAAAQCAPGLPEAQCAPCALRARRARRCYLLSV
70-140
ALRLLAELTFLGGQALLYGFRVAPHFACAGPPCPHTVDCFVSRPTEKTVFVLFYFAVGLLSALLSVAELG
140-210
HLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPPPALPSRRPGPEPCAPPAYAHPAPASLRECGSGR
210-280
GKASPATGRRDLAI
280-294
MGEWAFLGSLLDAVQLQSPLVGRLWLVVMLIFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLFHILLLSAPPVLFVVYSMHRAGKEAGGAEAAAQCAPGLPEAQCAPCALRARRARRCYLLSVALRLLAELTFLGGQALLYGFRVAPHFACAGPPCPHTVDCFVSRPTEKTVFVLFYFAVGLLSALLSVAELGHLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPPPALPSRRPGPEPCAPPAYAHPAPASLRECGSGRGKASPATGRRDLAI