You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MSMB
Beta-microseminoprotein

Protein Summary
Description
The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000581478
  • ENSP00000462641
  • ENSG00000263639
  • ENST00000582163
  • ENSP00000463092

Symbol
  • PRSP
  • MSP
  • PSP
  • IGBF
  • MSPB
  • PN44
  • PRPS
  • HPC13
  • PSP57
  • PSP94
  • PSP-94
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.97
cell type or tissue
0.89
tissue
0.6
biological term
0.59
small molecule perturbation
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 310.4   (req: < 5)
Gene RIFs: 51   (req: <= 3)
Antibodies: 602   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 310.4   (req: >= 5)
Gene RIFs: 51   (req: > 3)
Antibodies: 602   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (2)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (95)
1 – 10 of 95
WDYHV1
Tdark
Family: Enzyme
Novelty: 0.23412216
p_int: 0.999997662
p_ni: 0.000002305
p_wrong: 3.3e-8
Data Source: BioPlex
SLC4A7
Tbio
Family: Transporter
Novelty: 0.01401859
p_int: 0.999991886
p_ni: 0.000008114
Data Source: BioPlex
CHST3
Tbio
Family: Enzyme
Novelty: 0.00504727
p_int: 0.999612077
p_ni: 0.00018922
p_wrong: 0.000198703
Data Source: BioPlex
C4A
Tbio
Novelty: 0.00075974
p_int: 0.999372886
p_ni: 0.000382114
p_wrong: 0.000245
Data Source: BioPlex
HTRA1
Tbio
Family: Enzyme
Novelty: 0.00171455
p_int: 0.998882072
p_ni: 0.000533497
p_wrong: 0.000584431
Data Source: BioPlex
PEX6
Tbio
Family: Enzyme
Novelty: 0.01134558
p_int: 0.997747598
p_ni: 0.002252129
p_wrong: 2.73e-7
Data Source: BioPlex
SEMA6A
Tbio
Novelty: 0.0073015
p_int: 0.99474712
p_ni: 0.005251781
p_wrong: 0.000001099
Data Source: BioPlex
WNT5A
Tbio
Novelty: 0.00148207
p_int: 0.994565282
p_ni: 0.005434716
p_wrong: 2e-9
Data Source: BioPlex
VCAN
Tbio
Novelty: 0.00132314
p_int: 0.99388468
p_ni: 0.003325052
p_wrong: 0.002790269
Data Source: BioPlex
LINGO1
Tbio
Novelty: 0.01024316
p_int: 0.992107713
p_ni: 0.007861048
p_wrong: 0.000031239
Data Source: BioPlex
Publication Statistics
PubMed Score  310.40

PubMed score by year
PubTator Score  791.27

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCC
1-70
TLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
70-114
MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII