You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
PARP6
Poly [ADP-ribose] polymerase 6

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000260376
  • ENSP00000260376
  • ENSG00000137817
  • ENST00000287196
  • ENSP00000287196
  • ENST00000569795
  • ENSP00000456348

Symbol
  • ARTD17
  • pART17
  • PARP-6-C
  • PARP-6-B1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.98
transcription factor perturbation
0.84
transcription factor binding site profile
0.75
disease perturbation
0.74
transcription factor
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.71   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 159   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.71   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 159   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of vitamins and cofactors
Reactome
Metabolism of water-soluble vitamins and cofactors
Reactome
Nicotinamide salvaging
Reactome
Nicotinate metabolism
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of vitamins and cofactors
Metabolism of water-soluble vitamins and cofactors
Nicotinamide salvaging
Nicotinate metabolism
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (41)
1 – 10 of 41
PARP3
Tclin
Family: Enzyme
Novelty: 0.02371821
Score: 0.834
Data Source: STRINGDB
TNKS2
Tchem
Family: Enzyme
Novelty: 0.00207544
Score: 0.804
Data Source: STRINGDB
NMNAT3
Tbio
Family: Enzyme
Novelty: 0.04064292
Score: 0.713
Data Source: STRINGDB
NMNAT2
Tbio
Family: Enzyme
Novelty: 0.02195917
Score: 0.71
Data Source: STRINGDB
PARP10
Tchem
Family: Enzyme
Novelty: 0.0664592
Score: 0.7
Data Source: STRINGDB
TNKS
Tchem
Family: Enzyme
Novelty: 0.00134534
Score: 0.684
Data Source: STRINGDB
TMEM202
Tdark
Score: 0.679
Data Source: STRINGDB
PARP4
Tchem
Family: Enzyme
Novelty: 0.03103636
Score: 0.676
Data Source: STRINGDB
PARP9
Tbio
Family: Enzyme
Novelty: 0.04531483
Score: 0.67
Data Source: STRINGDB
PARP12
Tbio
Family: Enzyme
Novelty: 0.14117321
Score: 0.661
Data Source: STRINGDB
Publication Statistics
PubMed Score  6.71

PubMed score by year
PubTator Score  35.35

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEIYSENSVSIREYGTIDDVDID
1-70
LHINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNKEGFGLGLQLKKILGMFTSQ
70-140
QWKHLSNDFLKTQQEKRHSWFKASGTIKKFRAGLSIFSPIPKSPSFPIIQDSMLKGKLGVPELRVGRLMN
140-210
RSISCTMKNPKVEVFGYPPSPQAGLLCPQHVGLPPPARTSPLVSGHCKNIPTLEYGFLVQIMKYAEQRIP
210-280
TLNEYCVVCDEQHVFQNGSMLKPAVCTRELCVFSFYTLGVMSGAAEEVATGAEVVDLLVAMCRAALESPR
280-350
KSIIFEPYPSVVDPTDPKTLAFNPKKKNYERLQKALDSVMSIREMTQGSYLEIKKQMDKLDPLAHPLLQW
350-420
IISSNRSHIVKLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENWHSILRNGLVN
420-490
ASYTKLQLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRN
490-560
LNCIALCEVITSKDLQKHGNIWVCPVSDHVCTRFFFVYEDGQVGDANINTQDPKIQKEIMRVIGTQVYTN
560-630
MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEIYSENSVSIREYGTIDDVDIDLHINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNKEGFGLGLQLKKILGMFTSQQWKHLSNDFLKTQQEKRHSWFKASGTIKKFRAGLSIFSPIPKSPSFPIIQDSMLKGKLGVPELRVGRLMNRSISCTMKNPKVEVFGYPPSPQAGLLCPQHVGLPPPARTSPLVSGHCKNIPTLEYGFLVQIMKYAEQRIPTLNEYCVVCDEQHVFQNGSMLKPAVCTRELCVFSFYTLGVMSGAAEEVATGAEVVDLLVAMCRAALESPRKSIIFEPYPSVVDPTDPKTLAFNPKKKNYERLQKALDSVMSIREMTQGSYLEIKKQMDKLDPLAHPLLQWIISSNRSHIVKLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENWHSILRNGLVNASYTKLQLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRNLNCIALCEVITSKDLQKHGNIWVCPVSDHVCTRFFFVYEDGQVGDANINTQDPKIQKEIMRVIGTQVYTN