You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ITGAX
Integrin alpha-X

Protein Summary
Description
Integrin alpha-X/beta-2 is a receptor for fibrinogen. It recognizes the sequence G-P-R in fibrinogen. It mediates cell-cell interaction during inflammatory responses. It is especially important in monocyte adhesion and chemotaxis. This gene encodes the integrin alpha X chain protein. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as inactivated-C3b (iC3b) receptor 4 (CR4). The alpha X beta 2 complex seems to overlap the properties of the alpha M beta 2 integrin in the adherence of neutrophils and monocytes to stimulated endothelium cells, and in the phagocytosis of complement coated particles. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000268296
  • ENSP00000268296
  • ENSG00000140678

Symbol
  • CD11C
  • CD11C
  • SLEB6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.93
protein domain
0.85
biological term
0.69
cell type or tissue
0.64
disease perturbation
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1629.88   (req: < 5)
Gene RIFs: 68   (req: <= 3)
Antibodies: 2147   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1629.88   (req: >= 5)
Gene RIFs: 68   (req: > 3)
Antibodies: 2147   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (23)
Cell surface interactions at the vascular wall (R-HSA-202733)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell surface interactions at the vascular wall
Reactome
Cytokine Signaling in Immune system
Reactome
ECM proteoglycans
Reactome
Extracellular matrix organization
Reactome
Hemostasis
Name
Explore in Pharos
Explore in Source
Cell surface interactions at the vascular wall
Cytokine Signaling in Immune system
ECM proteoglycans
Extracellular matrix organization
Hemostasis
Gene Ontology Terms (17)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (459)
1 – 10 of 459
ITGB2
Tclin
Novelty: 0.00237551
Score: 0.997
Data Source: Reactome,STRINGDB
ICAM1
Tchem
Novelty: 0.00011154
Score: 0.982
Data Source: STRINGDB
CD80
Tclin
Novelty: 0.00038927
Score: 0.975
Data Source: STRINGDB
CLEC4C
Tbio
Novelty: 0.01109083
Score: 0.97
Data Source: STRINGDB
CD33
Tclin
Novelty: 0.00105063
Score: 0.969
Data Source: STRINGDB
LILRB2
Tbio
Novelty: 0.00812824
Score: 0.967
Data Source: STRINGDB
IL13
Tbio
Novelty: 0.00043714
Score: 0.966
Data Source: STRINGDB
ITGB1
Tclin
Novelty: 0.00074903
Score: 0.963
Data Source: Reactome,STRINGDB
SIRPA
Tbio
Family: Enzyme
Novelty: 0.00214138
Score: 0.959
Data Source: STRINGDB
CD86
Tclin
Novelty: 0.00036476
Score: 0.957
Data Source: STRINGDB
Publication Statistics
PubMed Score  1629.88

PubMed score by year
PubTator Score  673.77

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCG
1-70
YSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPV
70-140
SRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSS
140-210
NPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAG
210-280
IIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELE
280-350
MAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL
350-420
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGG
420-490
QVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVL
490-560
GPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPA
560-630
EIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSL
630-700
SRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKN
700-770
CGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQ
770-840
LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTS
840-910
KTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQE
910-980
AVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGN
980-1050
LSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLL
1050-1120
ALITAVLYKVGFFKRQYKEMMEEANGQIAPENGTQTPSPPSEK
1120-1163
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYKEMMEEANGQIAPENGTQTPSPPSEK