You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
VIPAS39
Spermatogenesis-defective protein 39 homolog

Protein Summary
Description
Proposed to be involved in endosomal maturation implicating in part VPS33B. In epithelial cells, the VPS33B:VIPAS39 complex may play a role in the apical RAB11A-dependent recycling pathway and in the maintenance of the apical-basolateral polarity (PubMed:20190753). May play a role in lysosomal trafficking, probably via association with the core HOPS complex in a discrete population of endosomes; the functions seems to be indepenedent of VPS33B (PubMed:19109425). May play a role in vesicular trafficking during spermatogenesis (By similarity). May be involved in direct or indirect transcriptional regulation of E-cadherin (By similarity). This gene encodes a protein involved in the sorting of lysosomal proteins. Mutations in this gene are associated with ARCS2 (arthrogryposis, renal dysfunction, and cholestasis-2). Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jul 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000327028
  • ENSP00000313098
  • ENSG00000151445
  • ENST00000343765
  • ENSP00000339122
  • ENST00000448935
  • ENSP00000404815
  • ENST00000553888
  • ENSP00000452181
  • ENST00000557658
  • ENSP00000452191

Symbol
  • C14orf133
  • SPE39
  • VIPAR
  • SPE39
  • VIPAR
  • SPE-39
  • VPS16B
  • hSPE-39
  • C14orf133
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.98
interacting protein
0.86
transcription factor binding site profile
0.86
histone modification site profile
0.81
transcription factor perturbation
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 27.95   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 106   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 27.95   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 106   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (14)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (38)
1 – 10 of 38
PLOD3
Tbio
Family: Enzyme
Novelty: 0.02714169
p_int: 0.999999949
p_ni: 5.1e-8
Score: 0.346
Data Source: BioPlex,STRINGDB
MATN4
Tbio
Novelty: 0.08666783
p_int: 0.999999893
p_ni: 1.05e-7
p_wrong: 2e-9
Score: 0.222
Data Source: BioPlex,STRINGDB
CCDC22
Tbio
Novelty: 0.01857112
p_int: 0.999998229
p_ni: 2.5e-8
p_wrong: 0.000001746
Score: 0.377
Data Source: BioPlex,STRINGDB
COLGALT2
Tbio
Family: Enzyme
Novelty: 0.43233256
p_int: 0.999995683
p_ni: 0.0000043
p_wrong: 1.7e-8
Score: 0.177
Data Source: BioPlex,STRINGDB
KIF1B
Tbio
Novelty: 0.00740293
p_int: 0.999963163
p_ni: 0.000036714
p_wrong: 1.22e-7
Score: 0.199
Data Source: BioPlex,STRINGDB
LYG2
Tbio
Family: Enzyme
Novelty: 0.15083867
p_int: 0.999441262
p_ni: 0.000210236
p_wrong: 0.000348503
Score: 0.169
Data Source: BioPlex,STRINGDB
RABIF
Tbio
Novelty: 0.63157895
p_int: 0.986329456
p_ni: 0.008989179
p_wrong: 0.004681365
Data Source: BioPlex
VPS33B
Tbio
Novelty: 0.02516107
Score: 0.997
Data Source: STRINGDB
VPS33A
Tbio
Novelty: 0.0570997
Score: 0.962
Data Source: STRINGDB
VPS16
Tbio
Novelty: 0.06780573
Score: 0.851
Data Source: STRINGDB
Publication Statistics
PubMed Score  27.95

PubMed score by year
PubTator Score  19.57

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWSGEPVGSISWS
1-70
IRETAGNSGSTHEGREQLKSRNSFSSYAQLPKPTSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPE
70-140
LGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSK
140-210
EILFRELEVRQVALRHLIHFLKEIGDQKLLLDLFRFLDRTEELALSHYREHLNIQDPDKRKEFLKTCVGL
210-280
PFSAEDSAHIQDHYTLLERQIIIEANDRHLESAGQTEIFRKHPRKASILNMPLVTTLFYSCFYHYTEAEG
280-350
TFSSPVNLKKTFKIPDKQYVLTALAARAKLRAWNDVDALFTTKNWLGYTKKRAPIGFHRVVEILHKNNAP
350-420
VQILQEYVNLVEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKIDALLSSSQIR
420-490
WKN
490-493
MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWSGEPVGSISWSIRETAGNSGSTHEGREQLKSRNSFSSYAQLPKPTSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPELGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSKEILFRELEVRQVALRHLIHFLKEIGDQKLLLDLFRFLDRTEELALSHYREHLNIQDPDKRKEFLKTCVGLPFSAEDSAHIQDHYTLLERQIIIEANDRHLESAGQTEIFRKHPRKASILNMPLVTTLFYSCFYHYTEAEGTFSSPVNLKKTFKIPDKQYVLTALAARAKLRAWNDVDALFTTKNWLGYTKKRAPIGFHRVVEILHKNNAPVQILQEYVNLVEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKIDALLSSSQIRWKN