You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DCAF8
DDB1- and CUL4-associated factor 8

Protein Summary
Description
May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. This gene encodes a WD repeat-containing protein that interacts with the Cul4-Ddb1 E3 ligase macromolecular complex. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000326837
  • ENSP00000318227
  • ENSG00000132716
  • ENST00000368073
  • ENSP00000357052
  • ENST00000368074
  • ENSP00000357053
  • ENST00000475733
  • ENSP00000476351
  • ENST00000610139
  • ENSP00000477464

Symbol
  • H326
  • WDR42A
  • GAN2
  • H326
  • WDR42A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.85
transcription factor binding site profile
0.83
kinase perturbation
0.76
histone modification site profile
0.71
disease perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.34   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 74   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.34   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 74   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Neddylation
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Neddylation
Post-translational protein modification
Gene Ontology Terms (8)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (95)
1 – 10 of 95
CUL4A
Tbio
Novelty: 0.01114245
p_int: 0.999925487
p_ni: 0.000074513
Score: 0.934
Data Source: BioPlex,STRINGDB
PDE7A
Tclin
Family: Enzyme
Novelty: 0.01228824
p_int: 0.999807889
p_ni: 0.000188461
p_wrong: 0.00000365
Data Source: BioPlex
METTL8
Tdark
Family: Enzyme
Novelty: 0.66666667
p_int: 0.999803555
p_ni: 0.00001763
p_wrong: 0.000178815
Data Source: BioPlex
AMPD2
Tchem
Family: Enzyme
Novelty: 0.01787589
p_int: 0.99976518
p_ni: 0.000234811
p_wrong: 1e-8
Data Source: BioPlex
CUL4B
Tbio
Novelty: 0.01789732
p_int: 0.99969849
p_ni: 0.00030151
Score: 0.946
Data Source: BioPlex,STRINGDB
FARP1
Tbio
Novelty: 0.02467814
p_int: 0.99886208
p_ni: 0.000625485
p_wrong: 0.000512434
Data Source: BioPlex
TFB1M
Tbio
Family: Enzyme
Novelty: 0.03295314
p_int: 0.993006535
p_ni: 0.006993465
Data Source: BioPlex
DDB1
Tbio
Novelty: 0.00396016
p_int: 0.992833319
p_ni: 0.007166681
Score: 0.966
Data Source: BioPlex,STRINGDB
ARHGEF26
Tbio
Novelty: 0.13375796
p_int: 0.991068361
p_ni: 0.006707929
p_wrong: 0.00222371
Data Source: BioPlex
ACAD11
Tbio
Family: Enzyme
Novelty: 0.55263158
p_int: 0.987790073
p_ni: 0.012209927
Data Source: BioPlex
Publication Statistics
PubMed Score  3.34

PubMed score by year
PubTator Score  9.78

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSLTGDDGGPNRTSTESRGTDTE
1-70
SSGEDKDSDSMEDTGHYSINDENRVHDRSEEEEEEEEEEEEEQPRRRVQRKRANRDQDSSDDERALEDWV
70-140
SSETSALPRPRWQALPALRERELGSSARFVYEACGARVFVQRFRLQHGLEGHTGCVNTLHFNQRGTWLAS
140-210
GSDDLKVVVWDWVRRQPVLDFESGHKSNVFQAKFLPNSGDSTLAMCARDGQVRVAELSATQCCKNTKRVA
210-280
QHKGASHKLALEPDSPCTFLSAGEDAVVFTIDLRQDRPASKLVVTKEKEKKVGLYTIYVNPANTHQFAVG
280-350
GRDQFVRIYDQRKIDENENNGVLKKFCPHHLVNSESKANITCLVYSHDGTELLASYNDEDIYLFNSSHSD
350-420
GAQYVKRYKGHRNNATVKGVNFYGPKSEFVVSGSDCGHIFLWEKSSCQIIQFMEGDKGGVVNCLEPHPHL
420-490
PVLATSGLDHDVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDLFDSHMLWFLMHHLRQRRHHRR
490-560
WREPGVGATDADSDESPSSSDTSDEEEGPDRVQCMPS
560-597
MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSLTGDDGGPNRTSTESRGTDTESSGEDKDSDSMEDTGHYSINDENRVHDRSEEEEEEEEEEEEEQPRRRVQRKRANRDQDSSDDERALEDWVSSETSALPRPRWQALPALRERELGSSARFVYEACGARVFVQRFRLQHGLEGHTGCVNTLHFNQRGTWLASGSDDLKVVVWDWVRRQPVLDFESGHKSNVFQAKFLPNSGDSTLAMCARDGQVRVAELSATQCCKNTKRVAQHKGASHKLALEPDSPCTFLSAGEDAVVFTIDLRQDRPASKLVVTKEKEKKVGLYTIYVNPANTHQFAVGGRDQFVRIYDQRKIDENENNGVLKKFCPHHLVNSESKANITCLVYSHDGTELLASYNDEDIYLFNSSHSDGAQYVKRYKGHRNNATVKGVNFYGPKSEFVVSGSDCGHIFLWEKSSCQIIQFMEGDKGGVVNCLEPHPHLPVLATSGLDHDVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDLFDSHMLWFLMHHLRQRRHHRRWREPGVGATDADSDESPSSSDTSDEEEGPDRVQCMPS