You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
KCNC2
Potassium voltage-gated channel subfamily C member 2

Protein Summary
Description
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain. Contributes to the regulation of the fast action potential repolarization and in sustained high-frequency firing in neurons of the central nervous system. Homotetramer channels mediate delayed-rectifier voltage-dependent potassium currents that activate rapidly at high-threshold voltages and inactivate slowly. Forms tetrameric channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane (PubMed:15709110). Can form functional homotetrameric and heterotetrameric channels that contain variable proportions of KCNC1, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties may be modulated either by the association with anci ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000298972
  • ENSP00000298972
  • ENSG00000166006
  • ENST00000350228
  • ENSP00000319877
  • ENST00000393288
  • ENSP00000376966
  • ENST00000540018
  • ENSP00000438423
  • ENST00000548513
  • ENSP00000449941
  • ENST00000549446
  • ENSP00000449253
  • ENST00000550433
  • ENSP00000448301

Symbol
  • KV3.2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.99
gene perturbation
0.81
molecular function
0.79
biological process
0.69
cell type or tissue
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 28.6   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 230   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 28.6   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 230   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Pathways (7)
Glucagon-like Peptide-1 (GLP1) regulates insulin secretion (R-HSA-381676)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Glucagon-like Peptide-1 (GLP1) regulates insulin secretion
Reactome
Integration of energy metabolism
Reactome
Metabolism
Reactome
Neuronal System
Reactome
Potassium Channels
Name
Explore in Pharos
Explore in Source
Glucagon-like Peptide-1 (GLP1) regulates insulin secretion
Integration of energy metabolism
Metabolism
Neuronal System
Potassium Channels
Gene Ontology Terms (40)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (155)
1 – 10 of 155
KCNAB1
Tbio
Family: IC
Novelty: 0.01799224
Score: 0.96
Data Source: STRINGDB
KCNAB2
Tbio
Family: IC
Novelty: 0.02072106
Score: 0.959
Data Source: STRINGDB
KCNAB3
Tbio
Family: IC
Novelty: 0.16424117
Score: 0.953
Data Source: STRINGDB
PRKAR1B
Tbio
Family: Enzyme
Novelty: 0.01102811
Score: 0.907
Data Source: STRINGDB
PRKAR1A
Tbio
Family: Enzyme
Novelty: 0.00372136
Score: 0.904
Data Source: STRINGDB
PRKACB
Tchem
Family: Kinase
Novelty: 0.03136062
Score: 0.904
Data Source: STRINGDB
PRKACG
Tbio
Family: Kinase
Novelty: 0.20113337
Score: 0.902
Data Source: STRINGDB
PRKAR2B
Tbio
Family: Enzyme
Novelty: 0.00534149
Score: 0.902
Data Source: STRINGDB
AKAP5
Tbio
Family: Enzyme
Novelty: 0.00763951
Score: 0.902
Data Source: STRINGDB
IQGAP1
Tbio
Family: Enzyme
Novelty: 0.00482573
Score: 0.902
Data Source: STRINGDB
Publication Statistics
PubMed Score  28.60

PubMed score by year
PubTator Score  12.8

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPL
1-70
SPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAF
70-140
WGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRR
140-210
LQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDP
210-280
ALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVV
280-350
RFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ
350-420
FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLP
420-490
RKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSVLSGDDSTGSEPPLSPPERLPI
490-560
RRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRSLNNIAGLAGNALRLSPVTSPYNSPCPLRRS
560-630
RSPIPSIL
630-638
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSVLSGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRSLNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL