You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
VDR
Vitamin D3 receptor

Protein Summary
Description
Nuclear receptor for calcitriol, the active form of vitamin D3 which mediates the action of this vitamin on cells (PubMed:28698609, PubMed:16913708, PubMed:15728261, PubMed:10678179). Enters the nucleus upon vitamin D3 binding where it forms heterodimers with the retinoid X receptor/RXR (PubMed:28698609). The VDR-RXR heterodimers bind to specific response elements on DNA and activate the transcription of vitamin D3-responsive target genes (PubMed:28698609). Plays a central role in calcium homeostasis (By similarity). This gene encodes vitamin D3 receptor, which is a member of the nuclear hormone receptor superfamily of ligand-inducible transcription factors. This receptor also functions as a receptor for the secondary bile acid, lithocholic acid. Downstream targets of vitamin D3 receptor are principally involved in mineral metabolism, though this receptor regulates a variety of other metabolic pathways, such as those involved in immune response and cancer. Mutations in this gene are as ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000229022
  • ENSP00000229022
  • ENSG00000111424
  • ENST00000395324
  • ENSP00000378734
  • ENST00000549336
  • ENSP00000449573
  • ENST00000550325
  • ENSP00000447173

Symbol
  • NR1I1
  • NR1I1
  • PPP1R163
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
biological process
0.99
virus perturbation
0.98
hub protein
0.97
chemical
0.95


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4038.72   (req: < 5)
Gene RIFs: 1346   (req: <= 3)
Antibodies: 722   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4038.72   (req: >= 5)
Gene RIFs: 1346   (req: > 3)
Antibodies: 722   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 41
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 101
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 9
Protein Data Bank (49)
1 – 5 of 49
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (124)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
Metabolism
Metabolism of lipids
Metabolism of proteins
Gene Ontology Terms (46)
Items per page:
10
1 – 10 of 15
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (202)
1 – 10 of 202
MED1
Tbio
Family: Enzyme
Novelty: 0.01259825
Score: 0.988
Data Source: STRINGDB
NCOA1
Tchem
Family: Epigenetic
Novelty: 0.00427551
Score: 0.974
Data Source: STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.969
Data Source: STRINGDB
SMAD3
Tbio
Family: TF
Novelty: 0.00058288
Score: 0.968
Data Source: STRINGDB
CREBBP
Tchem
Family: Epigenetic
Novelty: 0.00127032
Score: 0.964
Data Source: STRINGDB
BAZ1B
Tbio
Family: Epigenetic
Novelty: 0.03400267
Score: 0.962
Data Source: STRINGDB
RXRA
Tclin
Family: NR
Novelty: 0.00314166
Score: 0.955
Data Source: STRINGDB
SMAD4
Tbio
Family: TF
Novelty: 0.00064135
Score: 0.944
Data Source: STRINGDB
RXRB
Tclin
Family: NR
Novelty: 0.01518662
Score: 0.94
Data Source: STRINGDB
RXRG
Tclin
Family: NR
Novelty: 0.02152879
Score: 0.94
Data Source: STRINGDB
Publication Statistics
PubMed Score  4038.72

PubMed score by year
PubTator Score  4259.25

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITK
1-70
DNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHH
70-140
KTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEE
140-210
DSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFT
210-280
MDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAA
280-350
LIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
350-420
VFGNEIS
420-427
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS