Protein Classes
Protein Summary
Nuclear receptor for calcitriol, the active form of vitamin D3 which mediates the action of this vitamin on cells (PubMed:28698609, PubMed:16913708, PubMed:15728261, PubMed:10678179). Enters the nucleus upon vitamin D3 binding where it forms heterodimers with the retinoid X receptor/RXR (PubMed:28698609). The VDR-RXR heterodimers bind to specific response elements on DNA and activate the transcription of vitamin D3-responsive target genes (PubMed:28698609). Plays a central role in calcium homeostasis (By similarity). This gene encodes vitamin D3 receptor, which is a member of the nuclear hormone receptor superfamily of ligand-inducible transcription factors. This receptor also functions as a receptor for the secondary bile acid, lithocholic acid. Downstream targets of vitamin D3 receptor are principally involved in mineral metabolism, though this receptor regulates a variety of other metabolic pathways, such as those involved in immune response and cancer. Mutations in this gene are as ...more
- ENST00000229022
- ENSP00000229022
- ENSG00000111424
- ENST00000395324
- ENSP00000378734
- ENST00000549336
- ENSP00000449573
- ENST00000550325
- ENSP00000447173
- NR1I1
- NR1I1
- PPP1R163
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
|---|---|---|---|
molecular function | 1 | ||
biological process | 0.99 | ||
virus perturbation | 0.98 | ||
hub protein | 0.97 | ||
chemical | 0.95 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 4038.72 (req: < 5)
Gene RIFs: 1346 (req: <= 3)
Antibodies: 722 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 4038.72 (req: >= 5)
Gene RIFs: 1346 (req: > 3)
Antibodies: 722 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 41
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 101
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drugs: 9
Approved Drugs (9)
1 – 9 of 9
Active Ligands (101)
1 – 10 of 101
Protein Data Bank (49)
1 – 5 of 49
PDB Structure Id | Ligand | Method | Resolution (Å) | M.W. (kDa) | Pub Year | Title |
|---|
PDB Structure Id | M.W. | Resolution | Pub Year |
|---|
Pathways (124)
Reactome (13)
KEGG (4)
PathwayCommons (8)
WikiPathways (99)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 13
Data Source | Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|---|
Reactome | Gene expression (Transcription) | ||||
Reactome | Generic Transcription Pathway | ||||
Reactome | Metabolism | ||||
Reactome | Metabolism of lipids | ||||
Reactome | Metabolism of proteins | ||||
Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|
Gene expression (Transcription) | ||||
Generic Transcription Pathway | ||||
Metabolism | ||||
Metabolism of lipids | ||||
Metabolism of proteins | ||||
Gene Ontology Terms (46)
Functions (15)
Components (5)
Processes (26)
Items per page:
10
1 – 10 of 15
GO Term | Evidence | Assigned by | ||
|---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | MGI | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Protein-Protein Interactions (202)
1 – 10 of 202
MED1
Family: Enzyme
Novelty: 0.01259825
Score: 0.988
Data Source: STRINGDB
NCOA1
Family: Epigenetic
Novelty: 0.00427551
Score: 0.974
Data Source: STRINGDB
EP300
Family: Epigenetic
Novelty: 0.00060382
Score: 0.969
Data Source: STRINGDB
SMAD3
Family: TF
Novelty: 0.00058288
Score: 0.968
Data Source: STRINGDB
CREBBP
Family: Epigenetic
Novelty: 0.00127032
Score: 0.964
Data Source: STRINGDB
BAZ1B
Family: Epigenetic
Novelty: 0.03400267
Score: 0.962
Data Source: STRINGDB
RXRA
Family: NR
Novelty: 0.00314166
Score: 0.955
Data Source: STRINGDB
SMAD4
Family: TF
Novelty: 0.00064135
Score: 0.944
Data Source: STRINGDB
RXRB
Family: NR
Novelty: 0.01518662
Score: 0.94
Data Source: STRINGDB
RXRG
Family: NR
Novelty: 0.02152879
Score: 0.94
Data Source: STRINGDB
Publication Statistics
PubMed Score 4038.72
PubMed score by year
PubTator Score 4259.25
PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITK
1-70
DNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHH
70-140
KTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEE
140-210
DSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFT
210-280
MDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAA
280-350
LIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
350-420
VFGNEIS
420-427
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS
Find similar targets by: