You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DND1
Dead end protein homolog 1

Protein Summary
Description
RNA-binding factor that positively regulates gene expression by prohibiting miRNA-mediated gene suppression. Relieves miRNA repression in germline cells (By similarity). Prohibits the function of several miRNAs by blocking the accessibility of target mRNAs. Sequence-specific RNA-binding factor that binds specifically to U-rich regions (URRs) in the 3' untranslated region (3'-UTR) of several mRNAs. Does not bind to miRNAs. May play a role during primordial germ cell (PGC) survival (By similarity). However, does not seem to be essential for PGC migration (By similarity). This gene encodes a protein that binds to microRNA-targeting sequences of mRNAs, inhibiting microRNA-mediated repression. Reduced expression of this gene has been implicated in tongue squamous cell carcinoma. Two pseudogenes of this gene are located on the long arm of chromosome 17. [provided by RefSeq, Dec 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000542735
  • ENSP00000445366
  • ENSG00000256453

Symbol
  • RBMS4
  • RBMS4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.62
cell type or tissue
0.57
transcription factor perturbation
0.54
phenotype
0.43
chemical
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 29.19   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 202   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 29.19   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 202   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Vitamin D Receptor Pathway
WikiPathways
Vitamin D Receptor Pathway
WikiPathways
Vitamin D Receptor Pathway
WikiPathways
Vitamin D Receptor Pathway
WikiPathways
Breast cancer pathway
Name
Explore in Pharos
Explore in Source
Vitamin D Receptor Pathway
Vitamin D Receptor Pathway
Vitamin D Receptor Pathway
Vitamin D Receptor Pathway
Breast cancer pathway
Gene Ontology Terms (7)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (42)
1 – 10 of 42
ATXN3
Tbio
Novelty: 0.00117907
p_int: 0.999412306
p_ni: 0.000028795
p_wrong: 0.000558899
Score: 0.269
Data Source: BioPlex,STRINGDB
PAIP2B
Tbio
Novelty: 0.86657497
p_int: 0.998857689
p_ni: 0.001139862
p_wrong: 0.000002449
Score: 0.228
Data Source: BioPlex,STRINGDB
RALGAPB
Tbio
Family: Enzyme
Novelty: 0.92307692
p_int: 0.989706682
p_ni: 0.010293314
p_wrong: 4e-9
Score: 0.261
Data Source: BioPlex,STRINGDB
EMB
Tbio
Novelty: 0.00148583
p_int: 0.982860689
p_ni: 0.003706775
p_wrong: 0.013432536
Score: 0.188
Data Source: BioPlex,STRINGDB
VCPIP1
Tbio
Novelty: 0.14789734
p_int: 0.981358066
p_ni: 0.018641934
Score: 0.196
Data Source: BioPlex,STRINGDB
ACTR3C
Tdark
Novelty: 0.24849398
p_int: 0.908692266
p_ni: 0.000020041
p_wrong: 0.091287693
Score: 0.324
Data Source: BioPlex,STRINGDB
NANOS3
Tbio
Novelty: 0.0228214
Score: 0.88
Data Source: STRINGDB
DAZL
Tbio
Novelty: 0.00522384
Score: 0.857
Data Source: STRINGDB
TDRD7
Tbio
Family: Epigenetic
Novelty: 0.05412255
Score: 0.788
Data Source: STRINGDB
NANOS1
Tbio
Novelty: 0.03824161
Score: 0.738
Data Source: STRINGDB
Publication Statistics
PubMed Score  29.19

PubMed score by year
PubTator Score  13.29

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQSKRDCELWCERVNPENKAALEAWVRETGIRLVQVNGQRKYGGPPPGWVGSPPPAGSEVFIGRLPQDVY
1-70
EHQLIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIATLHNHPLRPSCPLLVCRSTEKCEL
70-140
SVDGLPPNLTRSALLLALQPLGPGLQEARLLPSPGPAPGQIALLKFSSHRAAAMAKKALVEGQSHLCGEQ
140-210
VAVEWLKPDLKQRLRQQLVGPFLRSPQPEGSQLALARDKLGFQGARATLQLLCQRMKLGSPVFLTKCLGI
210-280
GPAGWHRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSESGANLLWSAGAEAGTM
280-350
VKQ
350-353
MQSKRDCELWCERVNPENKAALEAWVRETGIRLVQVNGQRKYGGPPPGWVGSPPPAGSEVFIGRLPQDVYEHQLIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIATLHNHPLRPSCPLLVCRSTEKCELSVDGLPPNLTRSALLLALQPLGPGLQEARLLPSPGPAPGQIALLKFSSHRAAAMAKKALVEGQSHLCGEQVAVEWLKPDLKQRLRQQLVGPFLRSPQPEGSQLALARDKLGFQGARATLQLLCQRMKLGSPVFLTKCLGIGPAGWHRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSESGANLLWSAGAEAGTMVKQ