You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NLRP2
NACHT, LRR and PYD domains-containing protein 2

Protein Summary
Description
Suppresses TNF- and CD40-induced NFKB1 activity at the level of the IKK complex, by inhibiting NFKBIA degradation induced by TNF. When associated with PYCARD, activates CASP1, leading to the secretion of mature proinflammatory cytokine IL1B. May be a component of the inflammasome, a protein complex which also includes PYCARD, CARD8 and CASP1 and whose function would be the activation of proinflammatory caspases. This gene is a member of the nucleotide-binding and leucine-rich repeat receptor (NLR) family, and is predicted to contain an N-terminal pyrin effector domain (PYD), a centrally-located nucleotide-binding and oligomerization domain (NACHT) and C-terminal leucine-rich repeats (LRR). Members of this gene family are thought to be important regulators of immune responses. This gene product interacts with components of the IkB kinase (IKK) complex, and can regulate both caspase-1 and NF-kB (nuclear factor kappa-light-chain-enhancer of activated B cells) activity. The pyrin domain is ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000339757
  • ENSP00000344074
  • ENSG00000022556
  • ENST00000391721
  • ENSP00000375601
  • ENST00000427260
  • ENSP00000402474
  • ENST00000448584
  • ENSP00000409370
  • ENST00000537859
  • ENSP00000440601
  • ENST00000543010
  • ENSP00000445135
  • ENST00000611410
  • ENSP00000479220
  • ENSG00000275843
  • ENST00000611642
  • ENSP00000484150
  • ENSG00000275082
  • ENST00000611676
  • ENSP00000481999
  • ENSG00000275399
  • ENST00000611679
  • ENSP00000484354
  • ENSG00000278682
  • ENST00000611772
  • ENSP00000479109
  • ENST00000613062
  • ENSP00000483281
  • ENSG00000273992
  • ENST00000613485
  • ENSP00000484351
  • ENST00000613825
  • ENSP00000483963
  • ENSG00000274638
  • ENST00000613851
  • ENSP00000482628
  • ENSG00000278789
  • ENST00000615173
  • ENSP00000482889
  • ENST00000615391
  • ENSP00000481851
  • ENST00000615521
  • ENSP00000479352
  • ENST00000616040
  • ENSP00000478876
  • ENST00000616903
  • ENSP00000482355
  • ENST00000616919
  • ENSP00000481564
  • ENST00000618018
  • ENSP00000483886
  • ENST00000618694
  • ENSP00000482465
  • ENST00000618731
  • ENSP00000478787
  • ENST00000618789
  • ENSP00000478318
  • ENSG00000275796
  • ENST00000618943
  • ENSP00000482309
  • ENST00000619281
  • ENSP00000478265
  • ENST00000619454
  • ENSP00000483528
  • ENST00000619664
  • ENSP00000478774
  • ENST00000619885
  • ENSP00000483389
  • ENST00000621057
  • ENSP00000484382
  • ENST00000621200
  • ENSP00000479783
  • ENST00000621239
  • ENSP00000479713
  • ENST00000621594
  • ENSP00000478450
  • ENST00000622042
  • ENSP00000482253
  • ENST00000622216
  • ENSP00000482044
  • ENST00000622444
  • ENSP00000482065
  • ENST00000622600
  • ENSP00000482727
  • ENST00000622773
  • ENSP00000484759
  • ENST00000622864
  • ENSP00000477726

Symbol
  • NALP2
  • NBS1
  • PAN1
  • PYPAF2
  • NBS1
  • PAN1
  • NALP2
  • PYPAF2
  • CLR19.9
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.81
tissue sample
0.63
PubMedID
0.62
protein domain
0.58
transcription factor
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 74.68   (req: < 5)
Gene RIFs: 22   (req: <= 3)
Antibodies: 290   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 74.68   (req: >= 5)
Gene RIFs: 22   (req: > 3)
Antibodies: 290   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (28)
Items per page:
1 – 5 of 28
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Nucleotide-binding Oligomerization Domain (NOD) pathway
WikiPathways
Nucleotide-binding Oligomerization Domain (NOD) pathway
WikiPathways
Nucleotide-binding Oligomerization Domain (NOD) pathway
WikiPathways
Nucleotide-binding Oligomerization Domain (NOD) pathway
WikiPathways
Focal Adhesion-PI3K-Akt-mTOR-signaling pathway
Name
Explore in Pharos
Explore in Source
Nucleotide-binding Oligomerization Domain (NOD) pathway
Nucleotide-binding Oligomerization Domain (NOD) pathway
Nucleotide-binding Oligomerization Domain (NOD) pathway
Nucleotide-binding Oligomerization Domain (NOD) pathway
Focal Adhesion-PI3K-Akt-mTOR-signaling pathway
Gene Ontology Terms (12)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
HGNC
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (36)
1 – 10 of 36
CARD8
Tbio
Family: Enzyme
Novelty: 0.00962965
Score: 0.812
Data Source: STRINGDB
PYCARD
Tbio
Novelty: 0.00561282
Score: 0.793
Data Source: STRINGDB
MEFV
Tbio
Novelty: 0.00090769
Score: 0.791
Data Source: STRINGDB
CASP1
Tchem
Family: Enzyme
Novelty: 0.00043112
Score: 0.685
Data Source: STRINGDB
CASP5
Tchem
Family: Enzyme
Novelty: 0.00907686
Score: 0.681
Data Source: STRINGDB
CCDC50
Tbio
Novelty: 0.1419791
Score: 0.662
Data Source: STRINGDB
KHDC3L
Tbio
Novelty: 0.05686294
Score: 0.642
Data Source: STRINGDB
FAF1
Tbio
Novelty: 0.01741429
Score: 0.641
Data Source: STRINGDB
COX6B2
Tdark
Family: Enzyme
Novelty: 0.18870622
Score: 0.622
Data Source: STRINGDB
NLRP5
Tbio
Novelty: 0.03114879
Score: 0.596
Data Source: STRINGDB
Publication Statistics
PubMed Score  74.68

PubMed score by year
PubTator Score  62.81

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEM
1-70
ASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGN
70-140
VICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVV
140-210
LYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQA
210-280
RKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEE
280-350
PIYIRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVP
350-420
TCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQTSVLHREDLERLGVQESDLRLFLDGDILR
420-490
QDRVSKGCYSFIHLSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLSGVERLRNPDLIQAGYYSFGL
490-560
ANEKRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVTDLQELLGCLYESQEEELVKEVMAQFKEISL
560-630
HLNAVDVVPSSFCVKHCRNLQKMSLQVIKENLPENVTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKD
630-700
LMGLAINDSFLSASLVRILCEQIASDTCHLQRVVFKNISPADAHRNLCLALRGHKTVTYLTLQGNDQDDM
700-770
FPALCEVLRHPECNLRYLGLVSCSATTQQWADLSLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKC
770-840
FLQRLSLENCHLTEANCKDLAAVLVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQTLVLWNCDIT
840-910
SDGCCDLTKLLQEKSSLLCLDLGLNHIGVKGMKFLCEALRKPLCNLRCLWLWGCSIPPFSCEDLCSALSC
910-980
NQSLVTLDLGQNPLGSSGVKMLFETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHP
980-1050
WAERPSSHDFMI
1050-1062
MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEEPIYIRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQTSVLHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLSGVERLRNPDLIQAGYYSFGLANEKRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVTDLQELLGCLYESQEEELVKEVMAQFKEISLHLNAVDVVPSSFCVKHCRNLQKMSLQVIKENLPENVTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKDLMGLAINDSFLSASLVRILCEQIASDTCHLQRVVFKNISPADAHRNLCLALRGHKTVTYLTLQGNDQDDMFPALCEVLRHPECNLRYLGLVSCSATTQQWADLSLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKCFLQRLSLENCHLTEANCKDLAAVLVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQTLVLWNCDITSDGCCDLTKLLQEKSSLLCLDLGLNHIGVKGMKFLCEALRKPLCNLRCLWLWGCSIPPFSCEDLCSALSCNQSLVTLDLGQNPLGSSGVKMLFETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHPWAERPSSHDFMI