You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KRT86
Keratin, type II cuticular Hb6

Protein Summary
Description
This gene encodes a type II keratin protein, which heterodimerizes with type I keratins to form hair and nails. This gene is present in a cluster of related genes and pseudogenes on chromosome 12. Mutations in this gene have been observed in patients with the hair disease monilethrix. [provided by RefSeq, Feb 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000293525
  • ENSP00000293525
  • ENSG00000170442
  • ENST00000423955
  • ENSP00000444533

Symbol
  • KRTHB6
  • HB6
  • Hb1
  • K86
  • MNX
  • KRTHB1
  • KRTHB6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
tissue sample
0.62
small molecule perturbation
0.52
gene perturbation
0.5
transcription factor
0.46


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 192.31   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 54   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 192.31   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 54   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (6)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (69)
1 – 10 of 69
KRT81
Tbio
Novelty: 0.06850258
Score: 0.946
Data Source: STRINGDB
KRT32
Tdark
Novelty: 13
Score: 0.936
Data Source: STRINGDB
KRT36
Tdark
Novelty: 0.54736842
Score: 0.934
Data Source: STRINGDB
KRT35
Tbio
Novelty: 0.02043185
Score: 0.934
Data Source: STRINGDB
KRT34
Tbio
Novelty: 0.1177908
Score: 0.933
Data Source: STRINGDB
KRT25
Tbio
Novelty: 0.24351194
Score: 0.932
Data Source: STRINGDB
KRT16
Tbio
Novelty: 0.00602741
Score: 0.932
Data Source: STRINGDB
KRT14
Tbio
Novelty: 0.0012542
Score: 0.929
Data Source: STRINGDB
KRT28
Tdark
Novelty: 2.18181818
Score: 0.927
Data Source: STRINGDB
KRT15
Tbio
Novelty: 0.00514754
Score: 0.927
Data Source: STRINGDB
Publication Statistics
PubMed Score  192.31

PubMed score by year
PubTator Score  77.42

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTCGSYCGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCGRSFGYRSGGV
1-70
CGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKLQF
70-140
YQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASELNHVQEVLEGYKKKYEEEVSLRATAENEFVA
140-210
LKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEEEIRVLQSHISDTSVVVKLDNSRDLNMDCIIAEIKA
210-280
QYDDIVTRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAV
280-350
AQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG
350-420
VGSVNVCVSSSRGGVVCGDLCASTTAPVVSTRVSSVPSNSNVVVGTTNACAPSARVGVCGGSCKRC
420-486
MTCGSYCGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASELNHVQEVLEGYKKKYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEEEIRVLQSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEGVGSVNVCVSSSRGGVVCGDLCASTTAPVVSTRVSSVPSNSNVVVGTTNACAPSARVGVCGGSCKRC