You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CITED2
Cbp/p300-interacting transactivator 2

Protein Summary
Description
Transcriptional coactivator of the p300/CBP-mediated transcription complex. Acts as a bridge, linking TFAP2 transcription factors and the p300/CBP transcriptional coactivator complex in order to stimulate TFAP2-mediated transcriptional activation. Positively regulates TGF-beta signaling through its association with the SMAD/p300/CBP-mediated transcriptional coactivator complex. Stimulates the peroxisome proliferator-activated receptors PPARA transcriptional activity. Enhances estrogen-dependent transactivation mediated by estrogen receptors. Acts also as a transcriptional corepressor; interferes with the binding of the transcription factors HIF1A or STAT2 and the p300/CBP transcriptional coactivator complex. Participates in sex determination and early gonad development by stimulating transcription activation of SRY. Plays a role in controlling left-right patterning during embryogenesis; potentiates transcriptional activation of NODAL-mediated gene transcription in the left lateral plat ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000367651
  • ENSP00000356623
  • ENSG00000164442
  • ENST00000536159
  • ENSP00000442831
  • ENST00000618718
  • ENSP00000479918

Symbol
  • MRG1
  • ASD8
  • MRG1
  • VSD2
  • MRG-1
  • P35SRJ
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
1
transcription factor binding site profile
0.99
biological process
0.98
transcription factor perturbation
0.94
disease perturbation
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 130.57   (req: < 5)
Gene RIFs: 37   (req: <= 3)
Antibodies: 214   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 130.57   (req: >= 5)
Gene RIFs: 37   (req: > 3)
Antibodies: 214   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 39
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (16)
Activation of the TFAP2 (AP-2) family of transcription factors (R-HSA-8866907)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of the TFAP2 (AP-2) family of transcription factors
Reactome
Cellular response to hypoxia
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Reactome
FOXO-mediated transcription
Name
Explore in Pharos
Explore in Source
Activation of the TFAP2 (AP-2) family of transcription factors
Cellular response to hypoxia
Cellular responses to external stimuli
Cellular responses to stress
FOXO-mediated transcription
Gene Ontology Terms (44)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Protein-Protein Interactions (88)
1 – 10 of 88
CREBBP
Tchem
Family: Epigenetic
Novelty: 0.00127032
Score: 0.999
Data Source: Reactome,STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.995
Data Source: Reactome,STRINGDB
TFAP2A
Tbio
Family: TF
Novelty: 0.0031574
Score: 0.971
Data Source: Reactome,STRINGDB
TFAP2C
Tbio
Family: TF
Novelty: 0.01218549
Score: 0.967
Data Source: Reactome,STRINGDB
HIF1A
Tchem
Family: TF
Novelty: 0.00031917
Score: 0.963
Data Source: STRINGDB
TFAP2B
Tbio
Family: TF
Novelty: 0.01864104
Score: 0.963
Data Source: Reactome,STRINGDB
PITX2
Tbio
Family: TF
Novelty: 0.00196459
Score: 0.94
Data Source: STRINGDB
EPAS1
Tchem
Novelty: 0.00460751
Score: 0.928
Data Source: STRINGDB
CITED4
Tbio
Novelty: 0.08180588
Score: 0.92
Data Source: STRINGDB
TFAP2E
Tbio
Family: TF
Novelty: 0.07719058
Score: 0.919
Data Source: STRINGDB
Publication Statistics
PubMed Score  130.57

PubMed score by year
PubTator Score  69.57

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIR
1-70
HAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHP
70-140
AAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPA
140-210
AMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC
210-270
MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC