You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SP7
Transcription factor Sp7

Protein Summary
Description
Transcriptional activator essential for osteoblast differentiation (PubMed:23457570). Binds to SP1 and EKLF consensus sequences and to other G/C-rich sequences (By similarity). Transcriptional activator essential for osteoblast differentiation. Binds to SP1 and EKLF consensus sequences and to other G/C-rich sequences. This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein is a bone specific transcription factor and is required for osteoblast differentiation and bone formation.[provided by RefSeq, Jul 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000303846
  • ENSP00000302812
  • ENSG00000170374
  • ENST00000536324
  • ENSP00000443827
  • ENST00000537210
  • ENSP00000441367

Symbol
  • OSX
  • OSX
  • OI11
  • OI12
  • osterix
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.61
transcription factor
0.57
microRNA
0.55
cell line
0.51
disease
0.48


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 665.94   (req: < 5)
Gene RIFs: 56   (req: <= 3)
Antibodies: 154   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 665.94   (req: >= 5)
Gene RIFs: 56   (req: > 3)
Antibodies: 154   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (53)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Reactome
RUNX2 regulates bone development
Reactome
RUNX2 regulates osteoblast differentiation
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
RUNX2 regulates bone development
RUNX2 regulates osteoblast differentiation
Gene Ontology Terms (13)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (135)
1 – 10 of 135
RUNX2
Tbio
Family: TF
Novelty: 0.00035641
Score: 0.967
Data Source: Reactome,STRINGDB
BGLAP
Tbio
Novelty: 0.00011426
Score: 0.95
Data Source: STRINGDB
BMP2
Tbio
Novelty: 0.00020018
Score: 0.919
Data Source: STRINGDB
CBFB
Tchem
Family: TF
Novelty: 0.08455808
Score: 0.914
Data Source: Reactome,STRINGDB
UCMA
Tbio
Novelty: 0.09023173
Score: 0.909
Data Source: STRINGDB
SPP1
Tbio
Novelty: 0.00020502
Score: 0.891
Data Source: STRINGDB
IBSP
Tbio
Novelty: 0.00108792
Score: 0.869
Data Source: STRINGDB
DLX5
Tbio
Family: TF
Novelty: 0.00579431
Score: 0.864
Data Source: STRINGDB
PITX2
Tbio
Family: TF
Novelty: 0.00196459
Score: 0.85
Data Source: STRINGDB
SOST
Tclin
Novelty: 0.00097341
Score: 0.846
Data Source: STRINGDB
Publication Statistics
PubMed Score  665.94

PubMed score by year
PubTator Score  255.55

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSASKTMGDAYPAPFTS
1-70
TNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYK
70-140
AGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQGTLPTGPAQPPLNPQLPTYPSDFAPLNPAPY
140-210
PAPHLLQPGPQHVLPQDVYKPKAVGNSGQLEGSGGAKPPRGASTGGSGGYGGSGAGRSSCDCPNCQELER
210-280
LGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTR
280-350
EKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPATPEKAPG
350-420
GSPEQSNLLEI
420-431
MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSASKTMGDAYPAPFTSTNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQGTLPTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQLEGSGGAKPPRGASTGGSGGYGGSGAGRSSCDCPNCQELERLGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPATPEKAPGGSPEQSNLLEI