You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SLC16A1
Monocarboxylate transporter 1

Protein Summary
Description
Proton-coupled monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. Depending on the tissue and on cicumstances, mediates the import or export of lactic acid and ketone bodies. Required for normal nutrient assimilation, increase of white adipose tissue and body weight gain when on a high-fat diet. Plays a role in cellular responses to a high-fat diet by modulating the cellular levels of lactate and pyruvate, small molecules that contribute to the regulation of central metabolic pathways and insulin secretion, with concomitant effects on plasma insulin levels and blood glucose homeostasis. The protein encoded by this gene is a proton-linked monocarboxylate transporter that catalyzes the movement of many monocarboxylates, such as lactate and pyruvate, across the plas ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369626
  • ENSP00000358640
  • ENSG00000155380
  • ENST00000538576
  • ENSP00000441065
  • ENST00000628110
  • ENSP00000485688
  • ENSG00000281917
  • ENST00000630362
  • ENSP00000486000

Symbol
  • MCT1
  • MCT
  • HHF7
  • MCT1
  • MCT1D
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug perturbation
1
transcription factor binding site profile
0.92
kinase perturbation
0.91
drug
0.89
histone modification site profile
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 230.27   (req: < 5)
Gene RIFs: 116   (req: <= 3)
Antibodies: 285   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 230.27   (req: >= 5)
Gene RIFs: 116   (req: > 3)
Antibodies: 285   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 65
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (65)
1 – 10 of 65
CHEMBL380192
chemical structure image
CHEMBL205742
chemical structure image
CHEMBL205526
chemical structure image
CHEMBL85752
chemical structure image
CHEMBL383669
chemical structure image
CHEMBL204887
chemical structure image
CHEMBL205807
chemical structure image
CHEMBL1221551
chemical structure image
CHEMBL315970
chemical structure image
CHEMBL208487
chemical structure image
Pathways (41)
Basigin interactions (R-HSA-210991)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Basigin interactions
Reactome
Cell surface interactions at the vascular wall
Reactome
Defective SLC16A1 causes symptomatic deficiency in lactate transport (SDLT)
Reactome
Disease
Reactome
Disorders of transmembrane transporters
Name
Explore in Pharos
Explore in Source
Basigin interactions
Cell surface interactions at the vascular wall
Defective SLC16A1 causes symptomatic deficiency in lactate transport (SDLT)
Disease
Disorders of transmembrane transporters
Gene Ontology Terms (27)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (55)
1 – 10 of 55
BSG
Tbio
Novelty: 0.00077805
Score: 0.986
Data Source: Reactome,STRINGDB
SLC18B1
Tdark
Family: Transporter
Novelty: 0.33898305
Score: 0.802
Data Source: STRINGDB
SLC18A1
Tchem
Family: Transporter
Novelty: 0.01036678
Score: 0.759
Data Source: STRINGDB
SLC5A8
Tchem
Family: Transporter
Novelty: 0.01112418
Score: 0.691
Data Source: STRINGDB
LDHA
Tchem
Family: Enzyme
Novelty: 0.00087377
Score: 0.68
Data Source: STRINGDB
TENT5A
Tbio
Novelty: 0.10907364
Score: 0.673
Data Source: STRINGDB
SLC39A9
Tbio
Family: Transporter
Novelty: 0.0825498
Score: 0.66
Data Source: STRINGDB
SLC17A1
Tbio
Family: Transporter
Novelty: 0.01817799
Score: 0.653
Data Source: STRINGDB
SLC2A1
Tchem
Family: Transporter
Novelty: 0.00033049
Score: 0.642
Data Source: STRINGDB
SLC39A8
Tbio
Family: Transporter
Novelty: 0.01305761
Score: 0.637
Data Source: STRINGDB
Publication Statistics
PubMed Score  230.27

PubMed score by year
PubTator Score  396.45

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMY
1-70
GGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFY
70-140
KRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKS
140-210
KASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAP
210-280
LVFLSSYGKSQHYSSEKSAFLLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLS
280-350
TTYVGFCVYAGFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK
350-420
YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTD
420-490
GGPKEEESPV
490-500
MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYGKSQHYSSEKSAFLLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLSTTYVGFCVYAGFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYKYTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTDGGPKEEESPV