You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ATF7IP
Activating transcription factor 7-interacting protein 1

Protein Summary
Description
Recruiter that couples transcriptional factors to general transcription apparatus and thereby modulates transcription regulation and chromatin formation. Can both act as an activator or a repressor depending on the context. Mediates MBD1-dependent transcriptional repression, probably by recruiting complexes containing SETDB1. Required to stimulate histone methyltransferase activity of SETDB1 and facilitate the conversion of dimethylated to trimethylated H3 'Lys-9' (H3K9me3). The complex formed with MBD1 and SETDB1 represses transcription and couples DNA methylation and histone H3 'Lys-9' trimethylation (H3K9me3). Facilitates telomerase TERT and TERC gene expression by SP1 in cancer cells. ATF7IP is a multifunctional nuclear protein that associates with heterochromatin. It can act as a transcriptional coactivator or corepressor depending upon its binding partners (summary by Liu et al., 2009 [PubMed 19106100]).[supplied by OMIM, Nov 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000261168
  • ENSP00000261168
  • ENSG00000171681
  • ENST00000536444
  • ENSP00000445955
  • ENST00000540793
  • ENSP00000444589
  • ENST00000543189
  • ENSP00000443179
  • ENST00000544627
  • ENSP00000440440

Symbol
  • MCAF
  • MCAF1
  • AM
  • MCAF
  • p621
  • MCAF1
  • ATF-IP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.93
kinase perturbation
0.91
transcription factor
0.77
biological process
0.74
hub protein
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.43   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 69   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.43   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 69   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (3)
Chromatin modifying enzymes (R-HSA-3247509)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Chromatin modifying enzymes
Reactome
Chromatin organization
Reactome
PKMTs methylate histone lysines
Name
Explore in Pharos
Explore in Source
Chromatin modifying enzymes
Chromatin organization
PKMTs methylate histone lysines
Gene Ontology Terms (13)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (65)
1 – 10 of 65
SETDB1
Tbio
Family: TF; Epigenetic
Novelty: 0.00522352
p_int: 1
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
VHL
Tchem
Family: Enzyme
Novelty: 0.00323188
p_int: 0.999999965
p_ni: 3.4e-8
p_wrong: 1e-9
Score: 0.8
Data Source: BioPlex,STRINGDB
ARL14EP
Tdark
Novelty: 1.2
p_int: 0.99999984
p_ni: 1.59e-7
p_wrong: 1e-9
Score: 0.959
Data Source: BioPlex,STRINGDB
CRYAA
Tbio
Novelty: 0.03207592
p_int: 0.999991771
p_ni: 0.000008228
p_wrong: 1e-9
Data Source: BioPlex
MTRF1
Tbio
Family: Enzyme
Novelty: 0.11938601
p_int: 0.999957454
p_ni: 0.000042544
p_wrong: 1e-9
Data Source: BioPlex
PRR20E
Tdark
p_int: 0.999576636
p_ni: 0.000422964
p_wrong: 4e-7
Score: 0.163
Data Source: BioPlex,STRINGDB
SUV39H1
Tchem
Family: Epigenetic
Novelty: 0.00504871
p_int: 0.999566597
p_ni: 0.000433402
p_wrong: 1e-9
Score: 0.752
Data Source: BioPlex,STRINGDB
TADA3
Tbio
Novelty: 0.02095177
p_int: 0.999538093
p_ni: 0.000461906
p_wrong: 2e-9
Data Source: BioPlex
RYBP
Tbio
Novelty: 0.01436012
p_int: 0.99947597
p_ni: 0.000524026
p_wrong: 5e-9
Score: 0.27
Data Source: BioPlex,STRINGDB
TNNC2
Tbio
Novelty: 0.11856592
p_int: 0.999049767
p_ni: 0.000947573
p_wrong: 0.00000266
Data Source: BioPlex
Publication Statistics
PubMed Score  18.43

PubMed score by year
PubTator Score  19.98

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDSLEEPQKKVFKARKTMRVSDRQQLEAVYKVKEELLKTDVKLLNGNHENGDLDPTSPLENMDYIKDKEE
1-70
VNGIEEICFDPEGSKAEWKETPCILSVNVKNKQDDDLNCEPLSPHNITPEPVSKLPAEPVSGDPAPGDLD
70-140
AGDPASGVLASGDSTSGDPTSSEPSSSDAASGDATSGDAPSGDVSPGDATSGDATADDLSSGDPTSSDPI
140-210
PGEPVPVEPISGDCAADDIASSEITSVDLASGAPASTDPASDDLASGDLSSSELASDDLATGELASDELT
210-280
SESTFDRTFEPKSVPVCEPVPEIDNIEPSSNKDDDFLEKNGADEKLEQIQSKDSLDEKNKADNNIDANEE
280-350
TLETDDTTICSDRPPENEKKVEEDIITELALGEDAISSSMEIDQGEKNEDETSADLVETINENVIEDNKS
350-420
ENILENTDSMETDEIIPILEKLAPSEDELTCFSKTSLLPIDETNPDLEEKMESSFGSPSKQESSESLPKE
420-490
AFLVLSDEEDISGEKDESEVISQNETCSPAEVESNEKDNKPEEEEQVIHEDDERPSEKNEFSRRKRSKSE
490-560
DMDNVQSKRRRYMEEEYEAEFQVKITAKGDINQKLQKVIQWLLEEKLCALQCAVFDKTLAELKTRVEKIE
560-630
CNKRHKTVLTELQAKIARLTKRFEAAKEDLKKRHEHPPNPPVSPGKTVNDVNSNNNMSYRNAGTVRQMLE
630-700
SKRNVSESAPPSFQTPVNTVSSTNLVTPPAVVSSQPKLQTPVTSGSLTATSVLPAPNTATVVATTQVPSG
700-770
NPQPTISLQPLPVILHVPVAVSSQPQLLQSHPGTLVTNQPSGNVEFISVQSPPTVSGLTKNPVSLPSLPN
770-840
PTKPNNVPSVPSPSIQRNPTASAAPLGTTLAVQAVPTAHSIVQATRTSLPTVGPSGLYSPSTNRGPIQMK
840-910
IPISAFSTSSAAEQNSNTTPRIENQTNKTIDASVSKKAADSTSQCGKATGSDSSGVIDLTMDDEESGASQ
910-980
DPKKLNHTPVSTMSSSQPVSRPLQPIQPAPPLQPSGVPTSGPSQTTIHLLPTAPTTVNVTHRPVTQVTTR
980-1050
LPVPRAPANHQVVYTTLPAPPAQAPLRGTVMQAPAVRQVNPQNSVTVRVPQTTTYVVNNGLTLGSTGPQL
1050-1120
TVHHRPPQVHTEPPRPVHPAPLPEAPQPQRLPPEAASTSLPQKPHLKLARVQSQNGIVLSWSVLEVDRSC
1120-1190
ATVDSYHLYAYHEEPSATVPSQWKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIYGRFGPFCDPQS
1190-1260
TDVISSTQSS
1260-1270
MDSLEEPQKKVFKARKTMRVSDRQQLEAVYKVKEELLKTDVKLLNGNHENGDLDPTSPLENMDYIKDKEEVNGIEEICFDPEGSKAEWKETPCILSVNVKNKQDDDLNCEPLSPHNITPEPVSKLPAEPVSGDPAPGDLDAGDPASGVLASGDSTSGDPTSSEPSSSDAASGDATSGDAPSGDVSPGDATSGDATADDLSSGDPTSSDPIPGEPVPVEPISGDCAADDIASSEITSVDLASGAPASTDPASDDLASGDLSSSELASDDLATGELASDELTSESTFDRTFEPKSVPVCEPVPEIDNIEPSSNKDDDFLEKNGADEKLEQIQSKDSLDEKNKADNNIDANEETLETDDTTICSDRPPENEKKVEEDIITELALGEDAISSSMEIDQGEKNEDETSADLVETINENVIEDNKSENILENTDSMETDEIIPILEKLAPSEDELTCFSKTSLLPIDETNPDLEEKMESSFGSPSKQESSESLPKEAFLVLSDEEDISGEKDESEVISQNETCSPAEVESNEKDNKPEEEEQVIHEDDERPSEKNEFSRRKRSKSEDMDNVQSKRRRYMEEEYEAEFQVKITAKGDINQKLQKVIQWLLEEKLCALQCAVFDKTLAELKTRVEKIECNKRHKTVLTELQAKIARLTKRFEAAKEDLKKRHEHPPNPPVSPGKTVNDVNSNNNMSYRNAGTVRQMLESKRNVSESAPPSFQTPVNTVSSTNLVTPPAVVSSQPKLQTPVTSGSLTATSVLPAPNTATVVATTQVPSGNPQPTISLQPLPVILHVPVAVSSQPQLLQSHPGTLVTNQPSGNVEFISVQSPPTVSGLTKNPVSLPSLPNPTKPNNVPSVPSPSIQRNPTASAAPLGTTLAVQAVPTAHSIVQATRTSLPTVGPSGLYSPSTNRGPIQMKIPISAFSTSSAAEQNSNTTPRIENQTNKTIDASVSKKAADSTSQCGKATGSDSSGVIDLTMDDEESGASQDPKKLNHTPVSTMSSSQPVSRPLQPIQPAPPLQPSGVPTSGPSQTTIHLLPTAPTTVNVTHRPVTQVTTRLPVPRAPANHQVVYTTLPAPPAQAPLRGTVMQAPAVRQVNPQNSVTVRVPQTTTYVVNNGLTLGSTGPQLTVHHRPPQVHTEPPRPVHPAPLPEAPQPQRLPPEAASTSLPQKPHLKLARVQSQNGIVLSWSVLEVDRSCATVDSYHLYAYHEEPSATVPSQWKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIYGRFGPFCDPQSTDVISSTQSS