You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
C1R
Complement C1r subcomponent

Protein Summary
Description
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system. This gene encodes a member of the peptidase S1 protein family. The encoded protein is a proteolytic subunit in the complement system C1 complex. The complement system acts as a mediator in the innate immune response by ultimately triggering phagocytosis, inflammation, and rupturing the bacterial cell wall. Mutations in this gene are associated with Ehlers-Danlos Syndrome. [provided by RefSeq, Dec 2018]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000542285
  • ENSP00000438615
  • ENSG00000159403

Symbol
  • EDSPD1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
virus perturbation
1
drug
0.79
gene perturbation
0.79
disease perturbation
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 103.29   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 323   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 103.29   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 323   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 12
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
nafamostat
chemical structure image
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (16)
Classical antibody-mediated complement activation (R-HSA-173623)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Classical antibody-mediated complement activation
Reactome
Complement cascade
Reactome
Creation of C4 and C2 activators
Reactome
Immune System
Reactome
Initial triggering of complement
Name
Explore in Pharos
Explore in Source
Classical antibody-mediated complement activation
Complement cascade
Creation of C4 and C2 activators
Immune System
Initial triggering of complement
Protein-Protein Interactions (104)
1 – 10 of 104
C1S
Tchem
Novelty: 0.00094571
p_int: 0.999999446
p_ni: 3.03e-7
p_wrong: 2.51e-7
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
C1RL
Tbio
Family: Enzyme
Novelty: 0.24566192
p_int: 0.999962467
p_ni: 5.6e-8
p_wrong: 0.000037478
Score: 0.735
Data Source: BioPlex,STRINGDB
BIRC2
Tchem
Novelty: 0.00265344
p_int: 0.976344785
p_ni: 0.02365515
p_wrong: 6.4e-8
Score: 0.178
Data Source: BioPlex,STRINGDB
LRRC15
Tbio
Novelty: 0.00183551
p_int: 0.767751191
p_ni: 0.232248806
p_wrong: 3e-9
Score: 0.277
Data Source: BioPlex,STRINGDB
SERPING1
Tbio
Family: Enzyme
Novelty: 0.00076515
Score: 0.995
Data Source: Reactome,STRINGDB
C4B
Tbio
Novelty: 0.00094534
Score: 0.977
Data Source: Reactome,STRINGDB
C4A
Tbio
Novelty: 0.00075974
Score: 0.977
Data Source: Reactome,STRINGDB
C1QB
Tbio
Novelty: 0.01970194
Score: 0.977
Data Source: Reactome,STRINGDB
C1QA
Tbio
Novelty: 0.01665357
Score: 0.973
Data Source: Reactome,STRINGDB
C1QC
Tbio
Novelty: 0.04536303
Score: 0.968
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  103.29

PubMed score by year
PubTator Score  304.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVFQQFDLEPSEG
1-70
CFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQA
70-140
VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDTHSCQAECSSELYTEASGYISSLEY
140-210
PRSYPPDLRCNYSIRVERGLTLHLKFLEPFDIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSS
210-280
NAVDLLFFTDESGDSRGWKLRYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQV
280-350
LHSFTAVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSR
350-420
ESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRGGGA
420-490
LLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIAL
490-560
LELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRM
560-630
DVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKE
630-700
MEEED
700-705
MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDTHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPFDIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKLRYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSRESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED