You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CD19
B-lymphocyte antigen CD19

Protein Summary
Description
Assembles with the antigen receptor of B-lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000324662
  • ENSP00000313419
  • ENSG00000177455
  • ENST00000538922
  • ENSP00000437940
  • ENST00000567541
  • ENSP00000456201

Symbol
  • B4
  • CVID3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.89
hub protein
0.79
cell type or tissue
0.76
cellular component
0.7
biological term
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3706.68   (req: < 5)
Gene RIFs: 84   (req: <= 3)
Antibodies: 3891   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3706.68   (req: >= 5)
Gene RIFs: 84   (req: > 3)
Antibodies: 3891   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
blinatumomab
no chemical structure image available
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (30)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 17
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
Reactome
Complement cascade
Reactome
Constitutive Signaling by Aberrant PI3K in Cancer
Reactome
Disease
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
Complement cascade
Constitutive Signaling by Aberrant PI3K in Cancer
Disease
Protein-Protein Interactions (430)
1 – 10 of 430
POLR2M
Tbio
Family: Enzyme
Novelty: 0.10421601
p_int: 0.999972195
p_ni: 0.000027805
Score: 0.169
Data Source: BioPlex,STRINGDB
MINDY3
Tbio
Novelty: 0.03965367
p_int: 0.999499256
p_ni: 0.000500744
Score: 0.207
Data Source: BioPlex,STRINGDB
B3GNT3
Tbio
Family: Enzyme
Novelty: 0.05453491
p_int: 0.998629257
p_ni: 0.000136099
p_wrong: 0.001234644
Score: 0.218
Data Source: BioPlex,STRINGDB
IGSF8
Tbio
Novelty: 0.04429601
p_int: 0.938865204
p_ni: 0.061134794
p_wrong: 2e-9
Score: 0.403
Data Source: BioPlex,STRINGDB
CD79A
Tbio
Novelty: 0.00192293
Score: 0.996
Data Source: STRINGDB
CR2
Tbio
Novelty: 0.00116781
Score: 0.996
Data Source: Reactome,STRINGDB
LYN
Tclin
Family: Kinase
Novelty: 0.00137519
Score: 0.994
Data Source: STRINGDB
CD79B
Tclin
Novelty: 0.00265318
Score: 0.993
Data Source: STRINGDB
CD81
Tchem
Novelty: 0.00157371
Score: 0.987
Data Source: Reactome,STRINGDB
BTK
Tclin
Family: Kinase
Novelty: 0.000673
Score: 0.984
Data Source: STRINGDB
Publication Statistics
PubMed Score  3706.68

PubMed score by year
PubTator Score  2593.74

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPG
1-70
LGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRS
70-140
SEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRG
140-210
PLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVL
210-280
WHWLLRTGGWKVSAVTLAYLIFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGN
280-350
VLSLPTPTSGLGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF
350-420
YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLSPHGSAWDPSR
420-490
EATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTR
490-556
MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYLIFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSGLGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEFYENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLSPHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTR