You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
HTR2A
5-hydroxytryptamine receptor 2A

Protein Summary
Description
G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed:1330647, PubMed:18703043, PubMed:19057895). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD) (PubMed:28129538). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors (PubMed:28129538). Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways (PubMed:28129538). Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca(2+) ions from intracellular stores (PubMed:18703043, PubMed:28129538). Affects neural activity, perception, cognition and mood (PubMed:18297054). Plays ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000378688
  • ENSP00000367959
  • ENSG00000102468
  • ENST00000542664
  • ENSP00000437737
  • ENST00000543956
  • ENSP00000441861

Symbol
  • HTR2
  • HTR2
  • 5-HT2A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
drug
1
ligand (chemical)
1
chemical
0.9
kinase perturbation
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2246.45   (req: < 5)
Gene RIFs: 430   (req: <= 3)
Antibodies: 325   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2246.45   (req: >= 5)
Gene RIFs: 430   (req: > 3)
Antibodies: 325   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 43
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2047
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 79
Pathways (24)
Amine ligand-binding receptors (R-HSA-375280)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amine ligand-binding receptors
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Amine ligand-binding receptors
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Gene Ontology Terms (56)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (256)
1 – 10 of 256
GRM5
Tchem
Family: GPCR
Novelty: 0.00070884
Score: 0.964
Data Source: STRINGDB
GNAQ
Tbio
Novelty: 0.00176666
Score: 0.958
Data Source: STRINGDB
GRM1
Tchem
Family: GPCR
Novelty: 0.0009002
Score: 0.953
Data Source: STRINGDB
CCK
Tbio
Novelty: 0.00013779
Score: 0.952
Data Source: STRINGDB
OXT
Tbio
Novelty: 0.00006195
Score: 0.95
Data Source: STRINGDB
GNB3
Tbio
Novelty: 0.0043523
Score: 0.948
Data Source: STRINGDB
NPS
Tbio
Novelty: 0.00011983
Score: 0.947
Data Source: STRINGDB
GNA11
Tbio
Novelty: 0.00156526
Score: 0.947
Data Source: STRINGDB
TAC1
Tbio
Novelty: 0.00007711
Score: 0.946
Data Source: STRINGDB
NTS
Tbio
Novelty: 0.00035891
Score: 0.946
Data Source: STRINGDB
Publication Statistics
PubMed Score  2246.45

PubMed score by year
PubTator Score  2180.61

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGCLSPSCLSLLH
1-70
LQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYR
70-140
WPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGISMPI
140-210
PVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLAS
210-280
FSFLPQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICK
280-350
ESCNEDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
350-420
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
420-471
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGCLSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKSSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV