You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ENO2
Gamma-enolase

Protein Classes
Protein Summary
Description
Has neurotrophic and neuroprotective properties on a broad spectrum of central nervous system (CNS) neurons. Binds, in a calcium-dependent manner, to cultured neocortical neurons and promotes cell survival (By similarity). This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000229277
  • ENSP00000229277
  • ENSG00000111674
  • ENST00000535366
  • ENSP00000437402
  • ENST00000538763
  • ENSP00000441490
  • ENST00000541477
  • ENSP00000438873

Symbol
  • NSE
  • HEL-S-279
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.94
interacting protein
0.9
hub protein
0.88
small molecule perturbation
0.88
protein domain
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4734.79   (req: < 5)
Gene RIFs: 132   (req: <= 3)
Antibodies: 1910   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4734.79   (req: >= 5)
Gene RIFs: 132   (req: > 3)
Antibodies: 1910   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (15)
1 – 5 of 15
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (20)
Gluconeogenesis (R-HSA-70263)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gluconeogenesis
Reactome
Glucose metabolism
Reactome
Glycolysis
Reactome
Metabolism
Reactome
Metabolism of carbohydrates
Name
Explore in Pharos
Explore in Source
Gluconeogenesis
Glucose metabolism
Glycolysis
Metabolism
Metabolism of carbohydrates
Gene Ontology Terms (14)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
CAFA
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (261)
1 – 10 of 261
ENO3
Tbio
Family: Enzyme
Novelty: 0.00432053
p_int: 1
Score: 0.962
Data Source: BioPlex,STRINGDB
ENO1
Tchem
Family: Enzyme
Novelty: 0.00138287
p_int: 0.999959942
p_ni: 0.000040058
Score: 0.963
Data Source: BioPlex,STRINGDB
PGAM1
Tbio
Family: Enzyme
Novelty: 0.0137131
Score: 0.984
Data Source: STRINGDB
PKM
Tchem
Family: Kinase
Novelty: 0.00066016
Score: 0.981
Data Source: STRINGDB
PKLR
Tbio
Family: Kinase
Novelty: 0.00411221
Score: 0.98
Data Source: STRINGDB
GPI
Tbio
Family: Enzyme
Novelty: 0.00073017
Score: 0.972
Data Source: STRINGDB
PGAM2
Tbio
Family: Enzyme
Novelty: 0.02989704
Score: 0.964
Data Source: STRINGDB
BPGM
Tbio
Family: Enzyme
Novelty: 0.03453422
Score: 0.955
Data Source: STRINGDB
TPI1
Tbio
Family: Enzyme
Novelty: 0.00117277
Score: 0.955
Data Source: STRINGDB
PGK1
Tchem
Family: Kinase
Novelty: 0.00144192
Score: 0.945
Data Source: STRINGDB
Publication Statistics
PubMed Score  4734.79

PubMed score by year
PubTator Score  2858.08

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHIN
1-70
STIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGN
70-140
SDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDE
140-210
GGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALY
210-280
QDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSV
280-350
TEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
350-420
ARFAGHNFRNPSVL
420-434
MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL