You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
KMT2A
Histone-lysine N-methyltransferase 2A

Protein Summary
Description
Histone methyltransferase that plays an essential role in early development and hematopoiesis. Catalytic subunit of the MLL1/MLL complex, a multiprotein complex that mediates both methylation of 'Lys-4' of histone H3 (H3K4me) complex and acetylation of 'Lys-16' of histone H4 (H4K16ac). In the MLL1/MLL complex, it specifically mediates H3K4me, a specific tag for epigenetic transcriptional activation (PubMed:12453419, PubMed:20677832, PubMed:26886794). Has weak methyltransferase activity by itself, and requires other component of the MLL1/MLL complex to obtain full methyltransferase activity (PubMed:19187761, PubMed:26886794). Has no activity toward histone H3 phosphorylated on 'Thr-3', less activity toward H3 dimethylated on 'Arg-8' or 'Lys-9', while it has higher activity toward H3 acetylated on 'Lys-9'. Binds to unmethylated CpG elements in the promoter of target genes and helps maintain them in the nonmethylated state (PubMed:20010842). Required for transcriptional activation of HOXA ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000389506
  • ENSP00000374157
  • ENSG00000118058
  • ENST00000534358
  • ENSP00000436786
  • ENST00000649699
  • ENSP00000496927

Symbol
  • ALL1
  • CXXC7
  • HRX
  • HTRX
  • MLL
  • MLL1
  • TRX1
  • HRX
  • MLL
  • MLL1
  • TRX1
  • ALL-1
  • CXXC7
  • HTRX1
  • MLL1A
  • WDSTS
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
1
protein domain
1
molecular function
0.99
biological process
0.96
drug perturbation
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 684.11   (req: < 5)
Gene RIFs: 358   (req: <= 3)
Antibodies: 429   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 684.11   (req: >= 5)
Gene RIFs: 358   (req: > 3)
Antibodies: 429   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 30
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL3798088
chemical structure image
Protein Data Bank (27)
1 – 5 of 27
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (17)
Chromatin modifying enzymes (R-HSA-3247509)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Chromatin modifying enzymes
Reactome
Chromatin organization
Reactome
Developmental Biology
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Name
Explore in Pharos
Explore in Source
Chromatin modifying enzymes
Chromatin organization
Developmental Biology
Gene expression (Transcription)
Generic Transcription Pathway
Gene Ontology Terms (35)
Items per page:
10
1 – 10 of 12
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (259)
1 – 10 of 259
HCFC2
Tbio
Novelty: 0.2
p_int: 0.999999828
p_ni: 1.4e-7
p_wrong: 3.2e-8
Score: 0.834
Data Source: BioPlex,STRINGDB
WDR5
Tchem
Novelty: 0.00689807
p_int: 0.999998346
p_ni: 0.000001642
p_wrong: 1.2e-8
Score: 0.992
Data Source: BioPlex,STRINGDB
CSNK2B
Tbio
Family: Kinase
Novelty: 0.00171173
p_int: 0.999998045
p_ni: 0.000001955
Data Source: BioPlex
CSNK2A2
Tchem
Family: Kinase
Novelty: 0.00420757
p_int: 0.9999576
p_ni: 0.000042399
p_wrong: 1e-9
Score: 0.233
Data Source: BioPlex,STRINGDB
PIH1D1
Tbio
Novelty: 0.12194159
p_int: 0.986706964
p_ni: 0.013293035
Score: 0.551
Data Source: BioPlex,STRINGDB
ASB7
Tdark
Novelty: 0.78440367
p_int: 0.982902062
p_ni: 0.017097937
p_wrong: 1e-9
Score: 0.547
Data Source: BioPlex,STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.993
Data Source: STRINGDB
RBBP5
Tbio
Novelty: 0.0339304
Score: 0.991
Data Source: STRINGDB
ASH2L
Tbio
Family: Enzyme
Novelty: 0.02441135
Score: 0.99
Data Source: STRINGDB
KMT2C
Tbio
Family: Epigenetic
Novelty: 0.01077376
Score: 0.988
Data Source: STRINGDB
Publication Statistics
PubMed Score  684.11

PubMed score by year
PubTator Score  1651.79

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSS
1-70
GAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGG
70-140
GSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSGDKI
140-210
KKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKIKKLRAGKLSP
210-280
LKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQ
280-350
SPRRIKPVRIIPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSR
350-420
IIKTPRRFIEDEDYDPPIKIARLESTPNSRFSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDS
420-490
QASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGSRTTKKLSTLQSAPQQQTSSS
490-560
PPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ
560-630
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAP
630-700
RFTPSEAHSRIFESVTLPSNRTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPL
700-770
TPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFT
770-840
PGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQSSSALYPVGR
840-910
VSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTA
910-980
PSLEKEKTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPK
980-1050
AQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSE
1050-1120
DAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCK
1120-1190
MRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
1190-1260
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKK
1260-1330
QPPPPESGPEQSKQKKVAPRPSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHR
1330-1400
IRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQ
1400-1470
LENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTT
1470-1540
PGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEIL
1540-1610
SNLPESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESI
1610-1680
PSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKA
1680-1750
NSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLM
1750-1820
KKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRL