You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
BCLAF1
Bcl-2-associated transcription factor 1

Protein Classes
Protein Summary
Description
Death-promoting transcriptional repressor. May be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. This gene encodes a transcriptional repressor that interacts with several members of the BCL2 family of proteins. Overexpression of this protein induces apoptosis, which can be suppressed by co-expression of BCL2 proteins. The protein localizes to dot-like structures throughout the nucleus, and redistributes to a zone near the nuclear envelope in cells undergoing apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000353331
  • ENSP00000229446
  • ENSG00000029363
  • ENST00000392348
  • ENSP00000376159
  • ENST00000527759
  • ENSP00000434826
  • ENST00000530767
  • ENSP00000436501
  • ENST00000531224
  • ENSP00000435210

Symbol
  • BTF
  • KIAA0164
  • BTF
  • bK211L9.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug perturbation
1
interacting protein
1
transcription factor perturbation
0.97
transcription factor binding site profile
0.94
hub protein
0.92


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 220.31   (req: < 5)
Gene RIFs: 20   (req: <= 3)
Antibodies: 281   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 220.31   (req: >= 5)
Gene RIFs: 20   (req: > 3)
Antibodies: 281   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (14)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (111)
1 – 10 of 111
CLK2
Tchem
Family: Kinase
Novelty: 0.36216831
p_int: 0.993636665
p_ni: 0.006363335
Score: 0.732
Data Source: BioPlex,STRINGDB
ERH
Tbio
Novelty: 0.00493543
p_int: 0.993598491
p_ni: 0.006401509
Score: 0.503
Data Source: BioPlex,STRINGDB
SAP18
Tbio
Family: Enzyme
Novelty: 0.05845743
p_int: 0.991281915
p_ni: 0.008718085
Score: 0.264
Data Source: BioPlex,STRINGDB
SNRNP70
Tbio
Novelty: 0.00199593
p_int: 0.987444316
p_ni: 0.012555684
Score: 0.457
Data Source: BioPlex,STRINGDB
SNIP1
Tbio
Novelty: 0.0303933
p_int: 0.969814333
p_ni: 0.030185667
Score: 0.685
Data Source: BioPlex,STRINGDB
LUC7L2
Tdark
Novelty: 0.46134191
p_int: 0.961290093
p_ni: 0.038709907
Score: 0.237
Data Source: BioPlex,STRINGDB
PNN
Tbio
Novelty: 0.00945912
p_int: 0.947388808
p_ni: 0.052611192
Score: 0.776
Data Source: BioPlex,STRINGDB
LARP4B
Tbio
Novelty: 0.153294
p_int: 0.938491276
p_ni: 0.061508725
Data Source: BioPlex
PRMT8
Tchem
Family: Epigenetic
Novelty: 0.05036347
p_int: 0.934774799
p_ni: 0.065225201
Data Source: BioPlex
RNASEH1
Tchem
Family: Enzyme
Novelty: 0.04998588
p_int: 0.920572197
p_ni: 0.079427803
Data Source: BioPlex
Publication Statistics
PubMed Score  220.31

PubMed score by year
PubTator Score  27.22

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYSSRSRSRTYSRSRSRDRMYSRDYRRDYRNNRGMRRP
1-70
YGYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSVSSQRSRSRSRRSYRSSRSPR
70-140
SSSSRSSSPYSKSPVSKRRGSQEKQTKKAEGEPQEESPLKSKSQEEPKDTFEHDPSESIDEFNKSSATSG
140-210
DIWPGLSAYDNSPRSPHSPSPIATPPSQSSSCSDAPMLSTVHSAKNTPSQHSHSIQHSPERSGSGSVGNG
210-280
SSRYSPSQNSPIHHIPSRRSPAKTIAPQNAPRDESRGRSSFYPDGGDQETAKTGKFLKRFTDEESRVFLL
280-350
DRGNTRDKEASKEKGSEKGRAEGEWEDQEALDYFSDKESGKQKFNDSEGDDTEETEDYRQFRKSVLADQG
350-420
KSFATASHRNTEEEGLKYKSKVSLKGNRESDGFREEKNYKLKETGYVVERPSTTKDKHKEEDKNSERITV
420-490
KKETQSPEQVKSEKLKDLFDYSPPLHKNLDAREKSTFREESPLRIKMIASDSHRPEVKLKMAPVPLDDSN
490-560
RPASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQASKSTSESFIQHIVSLVHHVKEQYFKSAAMTLNE
560-630
RFTSYQKATEEHSTRQKSPEIHRRIDISPSTLRKHTRLAGEERVFKEENQKGDKKLRCDSADLRHDIDRR
630-700
RKERSKERGDSKGSRESSGSRKQEKTPKDYKEYKSYKDDSKHKREQDHSRSSSSSASPSSPSSREEKESK
700-770
KEREEEFKTHHEMKEYSGFAGVSRPRGTFFRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYT
770-840
PKSKKYFLHDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVEDEEETMENNEE
840-910
KKDRRKEEKE
910-920
MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYSSRSRSRTYSRSRSRDRMYSRDYRRDYRNNRGMRRPYGYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSVSSQRSRSRSRRSYRSSRSPRSSSSRSSSPYSKSPVSKRRGSQEKQTKKAEGEPQEESPLKSKSQEEPKDTFEHDPSESIDEFNKSSATSGDIWPGLSAYDNSPRSPHSPSPIATPPSQSSSCSDAPMLSTVHSAKNTPSQHSHSIQHSPERSGSGSVGNGSSRYSPSQNSPIHHIPSRRSPAKTIAPQNAPRDESRGRSSFYPDGGDQETAKTGKFLKRFTDEESRVFLLDRGNTRDKEASKEKGSEKGRAEGEWEDQEALDYFSDKESGKQKFNDSEGDDTEETEDYRQFRKSVLADQGKSFATASHRNTEEEGLKYKSKVSLKGNRESDGFREEKNYKLKETGYVVERPSTTKDKHKEEDKNSERITVKKETQSPEQVKSEKLKDLFDYSPPLHKNLDAREKSTFREESPLRIKMIASDSHRPEVKLKMAPVPLDDSNRPASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQASKSTSESFIQHIVSLVHHVKEQYFKSAAMTLNERFTSYQKATEEHSTRQKSPEIHRRIDISPSTLRKHTRLAGEERVFKEENQKGDKKLRCDSADLRHDIDRRRKERSKERGDSKGSRESSGSRKQEKTPKDYKEYKSYKDDSKHKREQDHSRSSSSSASPSSPSSREEKESKKEREEEFKTHHEMKEYSGFAGVSRPRGTFFRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYTPKSKKYFLHDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE