Protein Classes
Protein Summary
Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive (PubMed:28314590). This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine ...more
- ENST00000353247
- ENSP00000344132
- ENSG00000137752
- ENST00000436863
- ENSP00000410076
- ENST00000446369
- ENSP00000403260
- ENST00000525825
- ENSP00000434779
- ENST00000526568
- ENSP00000434250
- ENST00000531166
- ENSP00000434303
- ENST00000533400
- ENSP00000433138
- ENST00000534497
- ENSP00000436875
- IL1BC
- IL1BCE
- ICE
- P45
- IL1BC
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
|---|---|---|---|
virus perturbation | 1 | ||
protein domain | 0.99 | ||
biological process | 0.94 | ||
chemical | 0.93 | ||
transcription factor perturbation | 0.88 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 2015.82 (req: < 5)
Gene RIFs: 172 (req: <= 3)
Antibodies: 1028 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 2015.82 (req: >= 5)
Gene RIFs: 172 (req: > 3)
Antibodies: 1028 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 25
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 388
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Active Ligands (388)
1 – 10 of 388
Protein Data Bank (34)
1 – 5 of 34
PDB Structure Id | Ligand | Method | Resolution (Å) | M.W. (kDa) | Pub Year | Title |
|---|
PDB Structure Id | M.W. | Resolution | Pub Year |
|---|
Pathways (85)
Reactome (19)
KEGG (10)
PathwayCommons (6)
WikiPathways (50)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 19
Data Source | Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|---|
Reactome | Cytokine Signaling in Immune system | ||||
Reactome | Gene expression (Transcription) | ||||
Reactome | Generic Transcription Pathway | ||||
Reactome | Immune System | ||||
Reactome | Inflammasomes | ||||
Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|
Cytokine Signaling in Immune system | ||||
Gene expression (Transcription) | ||||
Generic Transcription Pathway | ||||
Immune System | ||||
Inflammasomes | ||||
Gene Ontology Terms (33)
Functions (8)
Components (8)
Processes (17)
Items per page:
10
1 – 8 of 8
GO Term | Evidence | Assigned by | ||
|---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | ParkinsonsUK-UCL | |||
Inferred from Physical Interaction (IPI) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | UniProtKB | |||
Inferred from Mutant Phenotype (IMP) | UniProtKB | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Traceable Author Statement (TAS) | ProtInc | |||
Protein-Protein Interactions (320)
1 – 10 of 320
PI4KB
Family: Kinase
Novelty: 0.01238722
p_int: 0.999999422
p_ni: 5.76e-7
p_wrong: 2e-9
Score: 0.3
Data Source: BioPlex,STRINGDB
KIF3A
Novelty: 0.00780024
p_int: 0.999717473
p_ni: 0.000282527
Score: 0.366
Data Source: BioPlex,STRINGDB
GAB1
Novelty: 0.02695105
p_int: 0.999619037
p_ni: 0.000380036
p_wrong: 9.27e-7
Score: 0.534
Data Source: BioPlex,STRINGDB
FMN2
Novelty: 0.01798553
p_int: 0.993082483
p_ni: 0.002241553
p_wrong: 0.004675964
Score: 0.336
Data Source: BioPlex,STRINGDB
PLCL2
Family: Enzyme
Novelty: 0.50270843
p_int: 0.992573304
p_ni: 0.000024811
p_wrong: 0.007401885
Score: 0.359
Data Source: BioPlex,STRINGDB
ARID4B
Family: TF; Epigenetic
Novelty: 0.05116399
p_int: 0.903419437
p_ni: 0.096580563
Score: 0.235
Data Source: BioPlex,STRINGDB
KIF11
Novelty: 0.00221368
p_int: 0.877714632
p_ni: 0.122285368
Score: 0.243
Data Source: BioPlex,STRINGDB
IL18
Novelty: 0.00038161
Score: 0.998
Data Source: Reactome,STRINGDB
PYCARD
Novelty: 0.00561282
Score: 0.997
Data Source: Reactome,STRINGDB
NLRP3
Novelty: 0.00042021
Score: 0.997
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score 2015.82
PubMed score by year
PubTator Score 1607.47
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQ
1-70
ICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEE
70-140
AQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASD
140-210
MTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVI
210-280
IIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFI
280-350
GRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
350-404
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Find similar targets by: