You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CASP1
Caspase-1

Protein Summary
Description
Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive (PubMed:28314590). This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000353247
  • ENSP00000344132
  • ENSG00000137752
  • ENST00000436863
  • ENSP00000410076
  • ENST00000446369
  • ENSP00000403260
  • ENST00000525825
  • ENSP00000434779
  • ENST00000526568
  • ENSP00000434250
  • ENST00000531166
  • ENSP00000434303
  • ENST00000533400
  • ENSP00000433138
  • ENST00000534497
  • ENSP00000436875

Symbol
  • IL1BC
  • IL1BCE
  • ICE
  • P45
  • IL1BC
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
protein domain
0.99
biological process
0.94
chemical
0.93
transcription factor perturbation
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2015.82   (req: < 5)
Gene RIFs: 172   (req: <= 3)
Antibodies: 1028   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2015.82   (req: >= 5)
Gene RIFs: 172   (req: > 3)
Antibodies: 1028   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 25
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 388
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (34)
1 – 5 of 34
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (85)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 19
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Immune System
Reactome
Inflammasomes
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Gene expression (Transcription)
Generic Transcription Pathway
Immune System
Inflammasomes
Gene Ontology Terms (33)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
ParkinsonsUK-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (320)
1 – 10 of 320
PI4KB
Tchem
Family: Kinase
Novelty: 0.01238722
p_int: 0.999999422
p_ni: 5.76e-7
p_wrong: 2e-9
Score: 0.3
Data Source: BioPlex,STRINGDB
KIF3A
Tbio
Novelty: 0.00780024
p_int: 0.999717473
p_ni: 0.000282527
Score: 0.366
Data Source: BioPlex,STRINGDB
GAB1
Tbio
Novelty: 0.02695105
p_int: 0.999619037
p_ni: 0.000380036
p_wrong: 9.27e-7
Score: 0.534
Data Source: BioPlex,STRINGDB
FMN2
Tbio
Novelty: 0.01798553
p_int: 0.993082483
p_ni: 0.002241553
p_wrong: 0.004675964
Score: 0.336
Data Source: BioPlex,STRINGDB
PLCL2
Tdark
Family: Enzyme
Novelty: 0.50270843
p_int: 0.992573304
p_ni: 0.000024811
p_wrong: 0.007401885
Score: 0.359
Data Source: BioPlex,STRINGDB
ARID4B
Tbio
Family: TF; Epigenetic
Novelty: 0.05116399
p_int: 0.903419437
p_ni: 0.096580563
Score: 0.235
Data Source: BioPlex,STRINGDB
KIF11
Tchem
Novelty: 0.00221368
p_int: 0.877714632
p_ni: 0.122285368
Score: 0.243
Data Source: BioPlex,STRINGDB
IL18
Tbio
Novelty: 0.00038161
Score: 0.998
Data Source: Reactome,STRINGDB
PYCARD
Tbio
Novelty: 0.00561282
Score: 0.997
Data Source: Reactome,STRINGDB
NLRP3
Tchem
Novelty: 0.00042021
Score: 0.997
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  2015.82

PubMed score by year
PubTator Score  1607.47

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQ
1-70
ICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEE
70-140
AQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASD
140-210
MTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVI
210-280
IIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFI
280-350
GRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
350-404
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH