You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TRIM3
Tripartite motif-containing protein 3

Protein Summary
Description
Probably involved in vesicular trafficking via its association with the CART complex (PubMed:15772161). The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation (PubMed:15772161). Positively regulates motility of microtubule-dependent motor protein KIF21B (By similarity). The protein encoded by this gene is a member of the tripartite motif (TRIM) family, also called the 'RING-B-box-coiled-coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic filaments. It is similar to a rat protein which is a specific partner for the tail domain of myosin V, a class of myosins which are involved in the targeted transport of organelles. The rat protein can also interact with alpha-actinin-4. Thus it is suggested that this human protein may play a role in myosin V-mediated cargo transport. Alternatively spli ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000345851
  • ENSP00000340797
  • ENSG00000110171
  • ENST00000359518
  • ENSP00000352508
  • ENST00000525074
  • ENSP00000433102
  • ENST00000536344
  • ENSP00000445460

Symbol
  • BERP
  • RNF22
  • RNF97
  • BERP
  • HAC1
  • RNF22
  • RNF97
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
kinase perturbation
0.81
hub protein
0.71
small molecule perturbation
0.65
tissue sample
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.45   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 227   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.45   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 227   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interferon Signaling
Reactome
Interferon gamma signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interferon Signaling
Interferon gamma signaling
Protein-Protein Interactions (170)
1 – 10 of 170
TRIM2
Tbio
Novelty: 0.10092294
p_int: 0.999999999
p_wrong: 1e-9
Score: 0.704
Data Source: BioPlex,STRINGDB
TMIE
Tbio
Novelty: 0.04105806
p_int: 0.933569403
p_ni: 0.066430482
p_wrong: 1.15e-7
Data Source: BioPlex
EMC4
Tdark
Novelty: 0.23166023
p_int: 0.932055097
p_ni: 0.067944826
p_wrong: 7.7e-8
Data Source: BioPlex
PML
Tbio
Novelty: 0.0021939
Score: 0.912
Data Source: STRINGDB
OASL
Tbio
Family: Enzyme
Novelty: 0.02020019
Score: 0.909
Data Source: STRINGDB
IRF7
Tbio
Family: TF
Novelty: 0.00308898
Score: 0.908
Data Source: STRINGDB
SP100
Tbio
Family: TF; Epigenetic
Novelty: 0.00264681
Score: 0.905
Data Source: STRINGDB
IRF9
Tbio
Family: TF
Novelty: 0.01154411
Score: 0.904
Data Source: STRINGDB
IRF3
Tbio
Family: TF
Novelty: 0.00132895
Score: 0.904
Data Source: STRINGDB
HLA-DQB1
Tbio
Novelty: 0.00238122
Score: 0.903
Data Source: STRINGDB
Publication Statistics
PubMed Score  32.45

PubMed score by year
PubTator Score  32.27

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAKREDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIPAQSLTLSCPVCRQTSILPE
1-70
QGVSALQNNFFISSLMEAMQQAPDGAHDPEDPHPLSVVAGRPLSCPNHEGKTMEFYCEACETAMCGECRA
70-140
GEHREHGTVLLRDVVEQHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQ
140-210
ALQQRKQALVSDLETICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAA
210-280
LAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHETVATGEGLRQALVGQPASLTVTTKDK
280-350
DGRLVRTGSAELRAEITGPDGTRLPVPVVDHKNGTYELVYTARTEGELLLSVLLYGQPVRGSPFRVRALR
350-420
PGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRGREKGEFTNLQ
420-490
GVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAVDTNGDIIVADYDNRWVSIF
490-560
SPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAV
560-630
NNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSG
630-700
SFLSYINTSAEPLYGPQGLALTSDGHVVVADAGNHCFKAYRYLQ
700-744
MAKREDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIPAQSLTLSCPVCRQTSILPEQGVSALQNNFFISSLMEAMQQAPDGAHDPEDPHPLSVVAGRPLSCPNHEGKTMEFYCEACETAMCGECRAGEHREHGTVLLRDVVEQHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHETVATGEGLRQALVGQPASLTVTTKDKDGRLVRTGSAELRAEITGPDGTRLPVPVVDHKNGTYELVYTARTEGELLLSVLLYGQPVRGSPFRVRALRPGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEPLYGPQGLALTSDGHVVVADAGNHCFKAYRYLQ