You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CFL1
Cofilin-1

Protein Summary
Description
Binds to F-actin and exhibits pH-sensitive F-actin depolymerizing activity. Regulates actin cytoskeleton dynamics. Important for normal progress through mitosis and normal cytokinesis. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required for the up-regulation of atypical chemokine receptor ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation (PubMed:11812157, PubMed:15580268, PubMed:21834987, PubMed:23633677). Required for neural tube morphogenesis and neural crest cell migration (By similarity). The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000308162
  • ENSP00000309629
  • ENSG00000172757
  • ENST00000525451
  • ENSP00000432660

Symbol
  • CFL
  • CFL
  • cofilin
  • HEL-S-15
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
biological process
0.98
transcription factor binding site profile
0.98
biological term
0.95
hub protein
0.95


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1412.32   (req: < 5)
Gene RIFs: 149   (req: <= 3)
Antibodies: 963   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1412.32   (req: >= 5)
Gene RIFs: 149   (req: > 3)
Antibodies: 963   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (41)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 23
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Cytokine Signaling in Immune system
Reactome
Developmental Biology
Reactome
EPH-Ephrin signaling
Reactome
EPHB-mediated forward signaling
Name
Explore in Pharos
Explore in Source
Axon guidance
Cytokine Signaling in Immune system
Developmental Biology
EPH-Ephrin signaling
EPHB-mediated forward signaling
Gene Ontology Terms (34)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (353)
1 – 10 of 353
CAP2
Tbio
Family: Enzyme
Novelty: 0.21052632
p_int: 0.999720318
p_ni: 0.000279682
Score: 0.927
Data Source: BioPlex,STRINGDB
CAP1
Tbio
Family: Enzyme
Novelty: 0.03666609
p_int: 0.963118194
p_ni: 0.036881806
Score: 0.957
Data Source: BioPlex,STRINGDB
ACTBL2
Tbio
Novelty: 0.35273907
p_int: 0.879026561
p_ni: 0.120973439
Score: 0.598
Data Source: BioPlex,STRINGDB
ACTB
Tbio
Novelty: 0.00027728
Score: 0.999
Data Source: STRINGDB
LIMK1
Tchem
Family: Kinase
Novelty: 0.0046681
Score: 0.997
Data Source: Reactome,STRINGDB
ACTG1
Tbio
Novelty: 0.00111542
Score: 0.997
Data Source: STRINGDB
SSH1
Tbio
Family: Enzyme
Novelty: 0.02721177
Score: 0.993
Data Source: STRINGDB
ACTA1
Tbio
Novelty: 0.00147233
Score: 0.991
Data Source: STRINGDB
LIMK2
Tchem
Family: Kinase
Novelty: 0.0180473
Score: 0.991
Data Source: STRINGDB
RHOA
Tbio
Family: Enzyme
Novelty: 0.0002729
Score: 0.988
Data Source: STRINGDB
Publication Statistics
PubMed Score  1412.32

PubMed score by year
PubTator Score  835.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYAT
1-70
FVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCY
70-140
EEVKDRCTLAEKLGGSAVISLEGKPL
140-166
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL