You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
KCNK9
Potassium channel subfamily K member 9

Protein Summary
Description
pH-dependent, voltage-insensitive, background potassium channel protein. This gene encodes a protein that contains multiple transmembrane regions and two pore-forming P domains and functions as a pH-dependent potassium channel. Amplification and overexpression of this gene have been observed in several types of human carcinomas. This gene is imprinted in the brain, with preferential expression from the maternal allele. A mutation in this gene was associated with Birk-Barel dysmorphism syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000303015
  • ENSP00000302166
  • ENSG00000169427
  • ENST00000520439
  • ENSP00000430676
  • ENST00000522317
  • ENSP00000429847
  • ENST00000648164
  • ENSP00000498198
  • ENST00000650269
  • ENSP00000496915

Symbol
  • TASK3
  • KT3.2
  • TASK3
  • K2p9.1
  • TASK-3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.91
cell line
0.68
hub protein
0.58
protein domain
0.58
tissue
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 134.72   (req: < 5)
Gene RIFs: 46   (req: <= 3)
Antibodies: 84   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 134.72   (req: >= 5)
Gene RIFs: 46   (req: > 3)
Antibodies: 84   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 40
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 6
Protein Data Bank (16)
1 – 5 of 16
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
Cardiac conduction (R-HSA-5576891)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cardiac conduction
Reactome
Muscle contraction
Reactome
Neuronal System
Reactome
Phase 4 - resting membrane potential
Reactome
Potassium Channels
Name
Explore in Pharos
Explore in Source
Cardiac conduction
Muscle contraction
Neuronal System
Phase 4 - resting membrane potential
Potassium Channels
Protein-Protein Interactions (65)
1 – 10 of 65
KCNK3
Tclin
Family: IC
Novelty: 0.00190411
Score: 0.907
Data Source: Reactome,STRINGDB
GYG1
Tbio
Family: Enzyme
Novelty: 0.01142463
Score: 0.807
Data Source: STRINGDB
NUDT6
Tbio
Novelty: 0.01804506
Score: 0.804
Data Source: STRINGDB
KCNJ9
Tbio
Family: IC
Novelty: 0.03269124
Score: 0.662
Data Source: STRINGDB
DLGAP2
Tbio
Novelty: 0.0374711
Score: 0.638
Data Source: STRINGDB
KCNA1
Tclin
Family: IC
Novelty: 0.00237321
Score: 0.629
Data Source: STRINGDB
KCNH1
Tclin
Family: IC
Novelty: 0.00131465
Score: 0.6
Data Source: STRINGDB
KCNA3
Tclin
Family: IC
Novelty: 0.00194142
Score: 0.595
Data Source: STRINGDB
DPP6
Tbio
Family: Enzyme
Novelty: 0.00786368
Score: 0.595
Data Source: STRINGDB
KCNJ10
Tbio
Family: IC
Novelty: 0.00337611
Score: 0.593
Data Source: STRINGDB
Publication Statistics
PubMed Score  134.72

PubMed score by year
PubTator Score  165.33

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSE
1-70
PHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLL
70-140
KRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQT
140-210
KGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPR
210-280
PSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSP
280-350
ISSISPGLHSFTDHQRLMKRRKSV
350-374
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV