You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PTDSS1
Phosphatidylserine synthase 1

Protein Classes
Protein Summary
Description
Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In membranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine. The protein encoded by this gene catalyzes the formation of phosphatidylserine from either phosphatidylcholine or phosphatidylethanolamine. Phosphatidylserine localizes to the mitochondria-associated membrane of the endoplasmic reticulum, where it serves a structural role as well as a signaling role. Defects in this gene are a cause of Lenz-Majewski hyperostotic dwarfism. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000517309
  • ENSP00000430548
  • ENSG00000156471
  • ENST00000522072
  • ENSP00000430928

Symbol
  • KIAA0024
  • PSSA
  • LMHD
  • PSS1
  • PSSA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
kinase perturbation
1
histone modification site profile
0.89
metabolite
0.88
transcription factor perturbation
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 95.48   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 140   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 95.48   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 140   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (12)
Glycerophospholipid biosynthesis (R-HSA-1483206)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Glycerophospholipid biosynthesis
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Phospholipid metabolism
Reactome
Synthesis of PS
Name
Explore in Pharos
Explore in Source
Glycerophospholipid biosynthesis
Metabolism
Metabolism of lipids
Phospholipid metabolism
Synthesis of PS
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (53)
1 – 10 of 53
PISD
Tbio
Family: Enzyme
Novelty: 0.00936733
Score: 0.978
Data Source: STRINGDB
PEMT
Tbio
Family: Enzyme
Novelty: 0.01013987
Score: 0.959
Data Source: STRINGDB
CEPT1
Tbio
Family: Enzyme
Novelty: 0.02109745
Score: 0.951
Data Source: STRINGDB
CHPT1
Tbio
Family: Enzyme
Novelty: 0.03546698
Score: 0.947
Data Source: STRINGDB
LPCAT4
Tdark
Family: Enzyme
Novelty: 0.22556391
Score: 0.923
Data Source: STRINGDB
LCAT
Tbio
Family: Enzyme
Novelty: 0.00426362
Score: 0.92
Data Source: STRINGDB
PTDSS2
Tbio
Family: Enzyme
Novelty: 0.12765957
Score: 0.919
Data Source: STRINGDB
LPCAT3
Tbio
Family: Enzyme
Novelty: 0.00564842
Score: 0.916
Data Source: STRINGDB
LPCAT2
Tbio
Family: Enzyme
Novelty: 0.027861
Score: 0.913
Data Source: STRINGDB
PLD2
Tchem
Family: Enzyme
Novelty: 0.00368183
Score: 0.913
Data Source: STRINGDB
Publication Statistics
PubMed Score  95.48

PubMed score by year
PubTator Score  27.48

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTIVSLMYFAFTRDDSVPEDNIW
1-70
RGILSVIFFFLIISVLAFPNGPFTRPHPALWRMVFGLSVLYFLFLVFLLFLNFEQVKSLMYWLDPNLRYA
70-140
TREADVMEYAVNCHVITWERIISHFDIFAFGHFWGWAMKALLIRSYGLCWTISITWELTELFFMHLLPNF
140-210
AECWWDQVILDILLCNGGGIWLGMVVCRFLEMRTYHWASFKDIHTTTGKIKRAVLQFTPASWTYVRWFDP
210-280
KSSFQRVAGVYLFMIIWQLTELNTFFLKHIFVFQASHPLSWGRILFIGGITAPTVRQYYAYLTDTQCKRV
280-350
GTQCWVFGVIGFLEAIVCIKFGQDLFSKTQILYVVLWLLCVAFTTFLCLYGMIWYAEHYGHREKTYSECE
350-420
DGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK
420-473
MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTIVSLMYFAFTRDDSVPEDNIWRGILSVIFFFLIISVLAFPNGPFTRPHPALWRMVFGLSVLYFLFLVFLLFLNFEQVKSLMYWLDPNLRYATREADVMEYAVNCHVITWERIISHFDIFAFGHFWGWAMKALLIRSYGLCWTISITWELTELFFMHLLPNFAECWWDQVILDILLCNGGGIWLGMVVCRFLEMRTYHWASFKDIHTTTGKIKRAVLQFTPASWTYVRWFDPKSSFQRVAGVYLFMIIWQLTELNTFFLKHIFVFQASHPLSWGRILFIGGITAPTVRQYYAYLTDTQCKRVGTQCWVFGVIGFLEAIVCIKFGQDLFSKTQILYVVLWLLCVAFTTFLCLYGMIWYAEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK