You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ST3GAL1
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1

Protein Summary
Description
Responsible for the synthesis of the sequence NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- found on sugar chains O-linked to Thr or Ser and also as a terminal sequence on certain gangliosides. SIAT4A and SIAT4B sialylate the same acceptor substrates but exhibit different Km values. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of the encoded protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B. Two transcript variants encoding the same protein have been found for this gene. Other transcript variants may exist, but have not been fully characterized yet. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000399640
  • ENSP00000414073
  • ENSG00000008513
  • ENST00000521180
  • ENSP00000428540
  • ENST00000522652
  • ENSP00000430515
  • ENST00000648219
  • ENSP00000497381

Symbol
  • SIAT4
  • SIAT4A
  • ST3O
  • SIAT4A
  • SIATFL
  • ST3GalA
  • ST3GalIA
  • Gal-NAc6S
  • ST3GalA.1
  • ST3GalIA,1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.93
transcription factor perturbation
0.91
transcription factor binding site profile
0.89
gene perturbation
0.88
PubMedID
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 78.22   (req: < 5)
Gene RIFs: 21   (req: <= 3)
Antibodies: 69   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 78.22   (req: >= 5)
Gene RIFs: 21   (req: > 3)
Antibodies: 69   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL3596261
chemical structure image
Pathways (22)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 14
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Reactome
Glycosaminoglycan metabolism
Reactome
Keratan sulfate biosynthesis
Reactome
Keratan sulfate/keratin metabolism
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Glycosaminoglycan metabolism
Keratan sulfate biosynthesis
Keratan sulfate/keratin metabolism
Protein-Protein Interactions (138)
1 – 10 of 138
GOLPH3
Tbio
Novelty: 0.00023848
p_int: 0.997501922
p_ni: 0.002495983
p_wrong: 0.000002094
Score: 0.251
Data Source: BioPlex,STRINGDB
ASPHD2
Tdark
Family: Enzyme
Novelty: 4
p_int: 0.978486311
p_ni: 0.021470028
p_wrong: 0.000043661
Data Source: BioPlex
SLC30A7
Tbio
Family: Transporter
Novelty: 0.04211849
p_int: 0.944470756
p_ni: 0.055529244
Score: 0.187
Data Source: BioPlex,STRINGDB
ATP2B2
Tbio
Family: Transporter
Novelty: 0.00724828
p_int: 0.932404023
p_ni: 0.067595977
Data Source: BioPlex
ITGAV
Tchem
Novelty: 0.00217401
p_int: 0.927776674
p_ni: 0.072223326
Score: 0.154
Data Source: BioPlex,STRINGDB
RMND1
Tbio
Novelty: 0.0888137
p_int: 0.90362607
p_ni: 0.096343422
p_wrong: 0.000030508
Data Source: BioPlex
ANKRD46
Tbio
Novelty: 0.04505658
p_int: 0.896879495
p_ni: 0.096385484
p_wrong: 0.006735021
Data Source: BioPlex
C6orf120
Tdark
Novelty: 0.6440678
p_int: 0.883341497
p_ni: 0.11326854
p_wrong: 0.003389962
Score: 0.161
Data Source: BioPlex,STRINGDB
SLC39A11
Tbio
Family: Transporter
Novelty: 0.17170679
p_int: 0.870039332
p_ni: 0.129960656
p_wrong: 1.2e-8
Data Source: BioPlex
UBE2J1
Tbio
Novelty: 0.05597139
p_int: 0.869051305
p_ni: 0.130948666
p_wrong: 3e-8
Score: 0.39
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  78.22

PubMed score by year
PubTator Score  44.9

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENLKRLIKHRPCTCTHCIGQRKL
1-70
SAWFDERFNQTMQPLLTAQNALLEDDTYRWWLRLQREKKPNNLNDTIKELFRVVPGNVDPMLEKRSVGCR
70-140
RCAVVGNSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEADVGTKTTHHLVYPESFRELGDNVSMILVPFK
140-210
TIDLEWVVSAITTGTISHTYIPVPAKIRVKQDKILIYHPAFIKYVFDNWLQGHGRYPSTGILSVIFSMHV
210-280
CDEVDLYGFGADSKGNWHHYWENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR
280-340
MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENLKRLIKHRPCTCTHCIGQRKLSAWFDERFNQTMQPLLTAQNALLEDDTYRWWLRLQREKKPNNLNDTIKELFRVVPGNVDPMLEKRSVGCRRCAVVGNSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEADVGTKTTHHLVYPESFRELGDNVSMILVPFKTIDLEWVVSAITTGTISHTYIPVPAKIRVKQDKILIYHPAFIKYVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR