You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RHOBTB2
Rho-related BTB domain-containing protein 2

Protein Summary
Description
The protein encoded by this gene is a small Rho GTPase and a candidate tumor suppressor. The encoded protein interacts with the cullin-3 protein, a ubiquitin E3 ligase necessary for mitotic cell division. This protein inhibits the growth and spread of some types of breast cancer. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000251822
  • ENSP00000251822
  • ENSG00000008853
  • ENST00000519685
  • ENSP00000427926
  • ENST00000522948
  • ENSP00000429141

Symbol
  • DBC2
  • KIAA0717
  • DBC2
  • EIEE64
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
transcription factor
0.78
molecular function
0.73
small molecule perturbation
0.69
disease perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 81.83   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 87   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 81.83   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 87   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (10)
Rho GTPase cycle (R-HSA-194840)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Rho GTPase cycle
Reactome
Signal Transduction
Reactome
Signaling by Rho GTPases
Name
Explore in Pharos
Explore in Source
Rho GTPase cycle
Signal Transduction
Signaling by Rho GTPases
Gene Ontology Terms (15)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (221)
1 – 10 of 221
APBB3
Tdark
Novelty: 0.21392217
p_int: 0.999999999
p_wrong: 1e-9
Score: 0.218
Data Source: BioPlex,STRINGDB
ARIH1
Tbio
Family: Enzyme
Novelty: 0.00502889
p_int: 0.997597394
p_ni: 0.002402606
Data Source: BioPlex
PKP3
Tbio
Novelty: 0.03295269
p_int: 0.97046912
p_ni: 0.029530701
p_wrong: 1.79e-7
Score: 0.333
Data Source: BioPlex,STRINGDB
TPM2
Tbio
Novelty: 0.00510926
p_int: 0.911972239
p_ni: 0.07109414
p_wrong: 0.016933621
Score: 0.248
Data Source: BioPlex,STRINGDB
DUSP14
Tbio
Family: Enzyme
Novelty: 0.06597118
p_int: 0.82550896
p_ni: 0.174490975
p_wrong: 6.5e-8
Score: 0.265
Data Source: BioPlex,STRINGDB
ARHGDIA
Tchem
Novelty: 0.00267642
Score: 0.967
Data Source: STRINGDB
MCF2
Tbio
Novelty: 0.0028608
Score: 0.967
Data Source: STRINGDB
VAV1
Tchem
Novelty: 0.00223848
Score: 0.966
Data Source: STRINGDB
ITSN1
Tbio
Novelty: 0.01483242
Score: 0.964
Data Source: STRINGDB
ARHGAP35
Tbio
Family: Enzyme
Novelty: 0.01196157
Score: 0.964
Data Source: STRINGDB
Publication Statistics
PubMed Score  81.83

PubMed score by year
PubTator Score  44.05

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEVLERSR
1-70
DVVDDVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGC
70-140
QLDLRYADLEAVNRARRPLARPIKPNEILPPEKGREVAKELGIPYYETSVVAQFGIKDVFDNAIRAALIS
140-210
RRHLQFWKSHLRNVQRPLLQAPFLPPKPPPPIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERVRIFA
210-280
HKIYLSTSSSKFYDLFLMDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCES
280-350
VDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSS
350-420
IQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVFDLRMMVANILNNEAFMNQEITKAFHVRRTNRV
420-490
KECLAKGTFSDVTFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYT
490-560
GMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELAQFHCAYQLADW
560-630
CLHHICTNYNNVCRKFPRDMKAMSPENQEYFEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLKRQPKRR
630-700
WLFWNSPSSPSSSAASSSSPSSSSAVV
700-727
MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQLDLRYADLEAVNRARRPLARPIKPNEILPPEKGREVAKELGIPYYETSVVAQFGIKDVFDNAIRAALISRRHLQFWKSHLRNVQRPLLQAPFLPPKPPPPIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERVRIFAHKIYLSTSSSKFYDLFLMDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCESVDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSSIQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVFDLRMMVANILNNEAFMNQEITKAFHVRRTNRVKECLAKGTFSDVTFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELAQFHCAYQLADWCLHHICTNYNNVCRKFPRDMKAMSPENQEYFEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLKRQPKRRWLFWNSPSSPSSSAASSSSPSSSSAVV