You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
CCDC149
Coiled-coil domain-containing protein 149

IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.16   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 27   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.16   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 27   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (15)
1 – 10 of 15
AADACL3
Tdark
Family: Enzyme
Novelty: 1
Score: 0.679
Data Source: STRINGDB
SEL1L3
Tdark
Novelty: 0.6331284
Score: 0.556
Data Source: STRINGDB
SGSH
Tbio
Family: Enzyme
Novelty: 0.00630911
Score: 0.533
Data Source: STRINGDB
ACAP2
Tbio
Novelty: 0.14217381
Score: 0.53
Data Source: STRINGDB
SLC35B4
Tbio
Family: Transporter
Novelty: 0.01580978
Score: 0.526
Data Source: STRINGDB
SERPINB7
Tbio
Novelty: 0.01951612
Score: 0.514
Data Source: STRINGDB
ADGRA3
Tbio
Family: GPCR
Novelty: 0.10970026
Score: 0.448
Data Source: STRINGDB
OTUD5
Tbio
Novelty: 0.10873083
Score: 0.444
Data Source: STRINGDB
KCNJ4
Tchem
Family: IC
Novelty: 0.01160219
Score: 0.441
Data Source: STRINGDB
CLIC6
Tbio
Family: IC
Novelty: 0.07088669
Score: 0.42
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.16

PubMed score by year
PubTator Score  0.25

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKL
1-70
LRMTIAKQRLGDEAIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASVDELQDVKEERSSYQDKVERL
70-140
NQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSKGQGKSSSSAL
140-210
TGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKL
210-280
RTLEVSGLWSLPGGKDTILFSDPTLPSGQRSRSPLLKFVEQPTENKADPKDGEAQKQEEDESCAAAEALT
280-350
APEDAGRPAVNSPANQSRGNQCKLFHPSLPQLPSEEEVNSLGREIIKLTKEQAAAELEEVRRESPIEGQR
350-420
SETGPAPPGLAIQGELPKSHLDSFEASRPAAKASTPEDGKGIPEGGGMRSTVKT
420-474
MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKLLRMTIAKQRLGDEAIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASVDELQDVKEERSSYQDKVERLNQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSKGQGKSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKLRTLEVSGLWSLPGGKDTILFSDPTLPSGQRSRSPLLKFVEQPTENKADPKDGEAQKQEEDESCAAAEALTAPEDAGRPAVNSPANQSRGNQCKLFHPSLPQLPSEEEVNSLGREIIKLTKEQAAAELEEVRRESPIEGQRSETGPAPPGLAIQGELPKSHLDSFEASRPAAKASTPEDGKGIPEGGGMRSTVKT