You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SATL1
Spermidine/spermine N(1)-acetyltransferase-like protein 1

IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 60   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 60   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (38)
1 – 10 of 38
C1orf141
Tdark
Novelty: 1.64423077
Score: 0.756
Data Source: STRINGDB
C8orf74
Tdark
Score: 0.709
Data Source: STRINGDB
C3orf14
Tdark
Novelty: 3.70460048
Score: 0.645
Data Source: STRINGDB
OR13A1
Tdark
Family: oGPCR
Score: 0.63
Data Source: STRINGDB
ZNF652
Tbio
Family: TF
Novelty: 0.17981376
Score: 0.57
Data Source: STRINGDB
APOOL
Tbio
Novelty: 0.18780965
Score: 0.566
Data Source: STRINGDB
ZNF711
Tbio
Family: TF
Novelty: 0.11882869
Score: 0.565
Data Source: STRINGDB
SHCBP1L
Tdark
Novelty: 0.30769231
Score: 0.557
Data Source: STRINGDB
POF1B
Tbio
Novelty: 0.16131097
Score: 0.557
Data Source: STRINGDB
FAM47B
Tdark
Score: 0.555
Data Source: STRINGDB
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
MSPPGMWQPGVQQPGISQQVPSHPDMSQPGMSQQVPSQPGIRQPDTSQSCKNQTDMSQPDANQSSLSDSN
1-70
QTGIIQPSPSLLGMNQMDMNQWSASLYEMNQVDMKQPSMSQAGMRQSGTNLPDINQPGMKQPGTWQLGRS
70-140
QPGMWPQSLSELVLSEASISQPGPPQRAPSQSGPRQSSTSQAGTNQSGISQPVMWQLDMRQSGGSQPSMR
140-210
QVGTSQSGTSQIGMSQPGTWQTGLSQPVPRQPNKSPPGMWQRGMWQPGMSQQVPSQLGMRQPGTSQSSKN
210-280
QTGMSHPGRGQPGIWEPGPSQPGLSQQDLNQLVLSQPGLSQPGRSQPSVSQMGMRQTSMDYFQIRHAEAG
280-350
DCPEILRLIKELAACENMLDAMELTAADLLRDGFGDNPLFYCLIAEVNDQQKPSGKLTVGFAMYYFTYDS
350-420
WTGKVLYLEDFYVTQAYQGLGIGAEMLKRLSQIAITTQCNCMHFLVVIWNQASINYYTSRGALDLSSEEG
420-490
WHLFRFNREELLDMAWEE
490-508
MSPPGMWQPGVQQPGISQQVPSHPDMSQPGMSQQVPSQPGIRQPDTSQSCKNQTDMSQPDANQSSLSDSNQTGIIQPSPSLLGMNQMDMNQWSASLYEMNQVDMKQPSMSQAGMRQSGTNLPDINQPGMKQPGTWQLGRSQPGMWPQSLSELVLSEASISQPGPPQRAPSQSGPRQSSTSQAGTNQSGISQPVMWQLDMRQSGGSQPSMRQVGTSQSGTSQIGMSQPGTWQTGLSQPVPRQPNKSPPGMWQRGMWQPGMSQQVPSQLGMRQPGTSQSSKNQTGMSHPGRGQPGIWEPGPSQPGLSQQDLNQLVLSQPGLSQPGRSQPSVSQMGMRQTSMDYFQIRHAEAGDCPEILRLIKELAACENMLDAMELTAADLLRDGFGDNPLFYCLIAEVNDQQKPSGKLTVGFAMYYFTYDSWTGKVLYLEDFYVTQAYQGLGIGAEMLKRLSQIAITTQCNCMHFLVVIWNQASINYYTSRGALDLSSEEGWHLFRFNREELLDMAWEE