You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KCNAB1
Voltage-gated potassium channel subunit beta-1

Protein Summary
Description
Cytoplasmic potassium channel subunit that modulates the characteristics of the channel-forming alpha-subunits (PubMed:7499366, PubMed:7603988, PubMed:17156368,PubMed:17540341, PubMed:19713757). Modulates action potentials via its effect on the pore-forming alpha subunits (By similarity). Promotes expression of the pore-forming alpha subunits at the cell membrane, and thereby increases channel activity (By similarity). Mediates closure of delayed rectifier potassium channels by physically obstructing the pore via its N-terminal domain and increases the speed of channel closure for other family members (PubMed:9763623). Promotes the closure of KCNA1, KCNA2 and KCNA5 channels (PubMed:7499366, PubMed:7890032, PubMed:7603988, PubMed:7649300, PubMed:8938711, PubMed:12077175, PubMed:12130714, PubMed:15361858, PubMed:17540341, PubMed:19713757). Accelerates KCNA4 channel closure (PubMed:7890032, PubMed:7649300, PubMed:7890764, PubMed:9763623). Accelerates the closure of heteromeric channels fo ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000302490
  • ENSP00000305858
  • ENSG00000169282
  • ENST00000471742
  • ENSP00000418956
  • ENST00000490337
  • ENSP00000419952

Symbol
  • KCNA1B
  • hKvb3
  • AKR6A3
  • KCNA1B
  • Kvb1.3
  • hKvBeta3
  • KV-BETA-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.99
microRNA
0.73
protein domain
0.73
cell line
0.69
transcription factor
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 56.15   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 339   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 56.15   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 339   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (11)
Neuronal System (R-HSA-112316)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Neuronal System
Reactome
Potassium Channels
Reactome
Voltage gated Potassium channels
Name
Explore in Pharos
Explore in Source
Neuronal System
Potassium Channels
Voltage gated Potassium channels
Gene Ontology Terms (27)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (77)
1 – 10 of 77
KCNAB2
Tbio
Family: IC
Novelty: 0.02072106
p_int: 0.999999999
p_ni: 1e-9
Score: 0.555
Data Source: BioPlex,Reactome,STRINGDB
KCNA2
Tclin
Family: IC
Novelty: 0.00260027
Score: 0.994
Data Source: STRINGDB
KCNA1
Tclin
Family: IC
Novelty: 0.00237321
Score: 0.992
Data Source: STRINGDB
KCNA5
Tclin
Family: IC
Novelty: 0.00228979
Score: 0.987
Data Source: STRINGDB
KCNA4
Tclin
Family: IC
Novelty: 0.00458772
Score: 0.985
Data Source: STRINGDB
KCNA3
Tclin
Family: IC
Novelty: 0.00194142
Score: 0.979
Data Source: STRINGDB
KCNB1
Tclin
Family: IC
Novelty: 0.00255633
Score: 0.972
Data Source: STRINGDB
KCNV1
Tclin
Family: IC
Novelty: 0.20762101
Score: 0.969
Data Source: STRINGDB
KCNS3
Tclin
Family: IC
Novelty: 0.08293831
Score: 0.966
Data Source: STRINGDB
KCND3
Tclin
Family: IC
Novelty: 0.00426758
Score: 0.965
Data Source: STRINGDB
Publication Statistics
PubMed Score  56.15

PubMed score by year
PubTator Score  36.73

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MLAARTGAAGSQISEENTKLRRQSGFSVAGKDKSPKKASENAKDSSLSPSGESQLRARQLALLREVEMNW
1-70
YLKLCDLSSEHTTVCTTGMPHRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAE
70-140
VYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFAN
140-210
RPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQ
210-280
LPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAER
280-350
LGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS
350-419
MLAARTGAAGSQISEENTKLRRQSGFSVAGKDKSPKKASENAKDSSLSPSGESQLRARQLALLREVEMNWYLKLCDLSSEHTTVCTTGMPHRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS