You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ADAM9
Disintegrin and metalloproteinase domain-containing protein 9

Protein Classes
Protein Summary
Description
Cleaves and releases a number of molecules with important roles in tumorigenesis and angiogenesis, such as TEK, KDR, EPHB4, CD40, VCAM1 and CDH5. May mediate cell-cell, cell-matrix interactions and regulate the motility of cells via interactions with integrins. Isoform 2: May act as alpha-secretase for amyloid precursor protein (APP). This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene interacts with SH3 domain-containing proteins, binds mitotic arrest deficient 2 beta protein, and is also involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor. Several alternatively spliced transcript variants ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000379917
  • ENSP00000369249
  • ENSG00000168615
  • ENST00000487273
  • ENSP00000419446

Symbol
  • KIAA0021
  • MCMP
  • MDC9
  • MLTNG
  • MCMP
  • MDC9
  • CORD9
  • Mltng
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.98
protein domain
0.97
molecular function
0.91
disease perturbation
0.9
transcription factor perturbation
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 144.25   (req: < 5)
Gene RIFs: 79   (req: <= 3)
Antibodies: 324   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 144.25   (req: >= 5)
Gene RIFs: 79   (req: > 3)
Antibodies: 324   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 33
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 24
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (7)
Collagen degradation (R-HSA-1442490)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Collagen degradation
Reactome
Degradation of the extracellular matrix
Reactome
Extracellular matrix organization
Name
Explore in Pharos
Explore in Source
Collagen degradation
Degradation of the extracellular matrix
Extracellular matrix organization
Gene Ontology Terms (40)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Mutant Phenotype (IMP)
BHF-UCL
Inferred from Mutant Phenotype (IMP)
BHF-UCL
Inferred from Mutant Phenotype (IMP)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (80)
1 – 10 of 80
SCGB1D4
Tdark
Novelty: 0.00109728
p_int: 0.999159896
p_ni: 0.000840104
Data Source: BioPlex
PTPRK
Tbio
Family: Enzyme
Novelty: 0.03472453
p_int: 0.997120602
p_ni: 0.002879397
p_wrong: 1e-9
Data Source: BioPlex
VEGFD
Tbio
Novelty: 0.00329663
p_int: 0.994234793
p_ni: 0.005765193
p_wrong: 1.4e-8
Score: 0.225
Data Source: BioPlex,STRINGDB
GPHA2
Tbio
Novelty: 0.0191488
p_int: 0.942302769
p_ni: 0.057697212
p_wrong: 1.9e-8
Score: 0.173
Data Source: BioPlex,STRINGDB
LYPD2
Tdark
Novelty: 0.92920354
p_int: 0.939686411
p_ni: 0.060312292
p_wrong: 0.000001297
Data Source: BioPlex
ADAM32
Tdark
Family: Enzyme
Novelty: 0.57613169
p_int: 0.905607425
p_ni: 0.094392573
p_wrong: 1e-9
Score: 0.2
Data Source: BioPlex,STRINGDB
PSCA
Tbio
Novelty: 0.00370639
p_int: 0.903137876
p_ni: 0.09682953
p_wrong: 0.000032593
Data Source: BioPlex
PATE1
Tbio
Novelty: 0.03158921
p_int: 0.890787403
p_ni: 0.10921057
p_wrong: 0.000002027
Data Source: BioPlex
INS
Tbio
Novelty: 0.00000614
p_int: 0.889642096
p_ni: 0.110326595
p_wrong: 0.000031309
Score: 0.222
Data Source: BioPlex,STRINGDB
CD160
Tbio
Novelty: 0.02046796
p_int: 0.863028095
p_ni: 0.136373367
p_wrong: 0.000598538
Data Source: BioPlex
Publication Statistics
PubMed Score  144.25

PubMed score by year
PubTator Score  126.22

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGSGARFPSGTLRVRWLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVI
1-70
QAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFGLRGLL
70-140
HLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQLLRRRRAVLPQ
140-210
TRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDV
210-280
LGNFVQWREKFLITRRRHDSAQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELG
280-350
HNLGMNHDDGRDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNK
350-420
LVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGTLCRGKTSECDVPEYCNGSS
420-490
QFCQPDVFIQNGYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCGFSGNEY
490-560
KKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICR
560-630
NFQCVDASVLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNCETKGYGGSVDSGPTYNEMNTALRDGLL
630-700
VFFFLIVPLIVCAIFIFIKRDQLWRSYFRKKRSQTYESDGKNQANPSRQPGSVPRHVSPVTPPREVPIYA
700-770
NRFAVPTYAAKQPQQFPSRPPPPQPKVSSQGNLIPARPAPAPPLYSSLT
770-819
MGSGARFPSGTLRVRWLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFGLRGLLHLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQLLRRRRAVLPQTRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDGRDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNKLVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGTLCRGKTSECDVPEYCNGSSQFCQPDVFIQNGYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCGFSGNEYKKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDASVLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNCETKGYGGSVDSGPTYNEMNTALRDGLLVFFFLIVPLIVCAIFIFIKRDQLWRSYFRKKRSQTYESDGKNQANPSRQPGSVPRHVSPVTPPREVPIYANRFAVPTYAAKQPQQFPSRPPPPQPKVSSQGNLIPARPAPAPPLYSSLT