You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CDKN2A
Cyclin-dependent kinase inhibitor 2A

Protein Summary
Description
Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein. This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported, two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene; this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with, and sequester, the E3 ubiquitin-protein ligase MDM2, a protein responsible for the degradation of p53. In spite of the structural and func ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000304494
  • ENSP00000307101
  • ENSG00000147889
  • ENST00000380151
  • ENSP00000369496
  • ENST00000494262
  • ENSP00000464952
  • ENST00000498124
  • ENSP00000418915
  • ENST00000498628
  • ENSP00000467857
  • ENST00000578845
  • ENSP00000467390

Symbol
  • CDKN2
  • MTS1
  • ARF
  • MLM
  • P14
  • P16
  • P19
  • CMM2
  • INK4
  • MTS1
  • TP16
  • CDK4I
  • CDKN2
  • INK4A
  • MTS-1
  • P14ARF
  • P19ARF
  • P16INK4
  • P16INK4A
  • P16-INK4A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
1
chemical
0.97
hub protein
0.95
biological process
0.91
cellular component
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9716.89   (req: < 5)
Gene RIFs: 1908   (req: <= 3)
Antibodies: 1199   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9716.89   (req: >= 5)
Gene RIFs: 1908   (req: > 3)
Antibodies: 1199   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (214)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 40
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Cell Cycle Checkpoints
Reactome
Cell Cycle, Mitotic
Reactome
Cellular Senescence
Reactome
Cellular responses to external stimuli
Name
Explore in Pharos
Explore in Source
Cell Cycle
Cell Cycle Checkpoints
Cell Cycle, Mitotic
Cellular Senescence
Cellular responses to external stimuli
Protein-Protein Interactions (596)
1 – 10 of 596
CDK4
Tclin
Family: Kinase
Novelty: 0.00051528
p_int: 0.998876334
p_ni: 0.001123666
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
IMPDH1
Tclin
Family: Enzyme
Novelty: 0.01078039
p_int: 0.953929757
p_ni: 0.046070243
Data Source: BioPlex
CDK6
Tclin
Family: Kinase
Novelty: 0.00168972
p_int: 0.930594938
p_ni: 0.069405062
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.997
Data Source: STRINGDB
MDM2
Tchem
Family: Enzyme
Novelty: 0.00036068
Score: 0.993
Data Source: STRINGDB
MYC
Tbio
Family: TF
Novelty: 0.000073
Score: 0.993
Data Source: STRINGDB
CCND1
Tchem
Novelty: 0.0001425
Score: 0.992
Data Source: STRINGDB
E2F1
Tbio
Family: TF
Novelty: 0.00369313
Score: 0.987
Data Source: STRINGDB
RB1
Tchem
Novelty: 0.00084849
Score: 0.985
Data Source: STRINGDB
HRAS
Tchem
Family: Enzyme
Novelty: 0.00008788
Score: 0.984
Data Source: STRINGDB
Publication Statistics
PubMed Score  9716.89

PubMed score by year
PubTator Score  6966.99

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEP
1-70
NCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGS
70-140
NHARIDAAEGPSDIPD
140-156
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD